Call Number /Title Summary Report 2001-2002 (Part II)

Call Number /Title Summary Report as Borrower
July 1, 2001 to June 30, 2002

Call Number Author Title Publication Date LCCN ISBN
N8223 .P48 1997 (ICU JRL Gen) PETHERBRIDGE, DEANNA Quick and the dead : artists and anatomy c1997   1853321729
N8224.M54 R33 1987 (FINE)   Race and representation : art/film/video, January 26-March 6, 1987 c1987 87406785  
N8237.25 .P47 2001 (PU fine) Pernoud, Emmanuel Bordel en peinture : l'art contre le goût c2001   287660230X
N8253 T68 A47 1989 (WEST)   Aesthetic Excursion : artists look at travel and transportation : Charles A. Wustum Museum of Fine Arts, June 10-September 13, 1989, Harry Nohr Gallery, University of Wisconsin-Platteville, September 25-October 11, 1989 1989  
N8551.P4 B82 (MAIN) (CONS)   Carved, incised, gilded and burnished : the Bucks County framemaking tradition c2000 00134350 1879636123
N8551.U6 A77 1988   Art of the frame : an exhibition focusing on American frames of the arts and crafts movement, 1870-1920, October 26-November 28, 1988 c1988  
N910.O7 A554 1987 (ARTL) National Gallery of Canada European and American painting, sculpture, and decorative arts 1987- 87202660 0888845316
NA\3770 .G8x\1992 \+\ Guardia, Milagros Mosaicos de la antigüedad tardía en Hispania : estudios de iconografía 1992 92211881 847665944X
NA260 .B34 1983   Bauplanung und Bautheorie der Antike [1983]  
NA260 .W55 1993 (HIS) Williams Symposium on Classical Architecture (2nd : 1993 : University of Pennsylvania) Appearance and essence : refinements of classical architecture - curvature : proceedings of the Second Williams Symposium on Classical Architecture held at the University of Pennsylvania, Philadelphia, April 2-4, 1993 1999 99006964 0924171766
NA2760 .N38 1982 (FAL) Naredi-Rainer, Paul v., 1950- Architektur und Harmonie : Zahl, Mass und Proportion in der abendländischen Baukunst c1982 83103244 3770111966
NA279.A35 G7 1993   Grands ateliers d'architecture dans le monde égéen du VIe siècle av. J.-C. : actes du colloque d'Istanbul, 23-25 mai 1991 1993   2906053309
NA283.T356 T57 1994 Giraud, Demosthenes Melete apokatastaseos tou naou tes Athenas Nikes : architektonike melete apokatastaseos 1994 95197666  
NA285\P3 +M47X\1993\(LC) Mertens, Dieter, Dr Alte Heratempel in Paestum und die archaische Baukunst in Unteritalien 1993   3805313314
NA2860 S28X\1996   Säule und Gebälk : zu Struktur und Wandlungsprozess griechisch-römischer Architektur : Bauforschungskolloquium in Berlin vom 16. bis 18. Juni 1994 c1996   3805317700
NA2870 .W4 1971 (MUSM) Wesenberg, Burkhardt Kapitelle und Basen, Beobachtungen z. Entstehung d. griech. Säulenformen 1971 72347588  
NA313 +C65\1998\(LC) Colini, Antonio Maria Stadium Domitiani 1998   887140128X
NA3683.C3 S34 1982 Schmidt, Evamaria Geschichte der Karyatide : Funktion und Bedeutung der menschlichen Träger- und Stützfigur in der Baukunst 1982 83166825 3878250363
NA3760 .W447x\1996 Weiss, Zeev Promise and redemption : a synagogue mosaic from Sepphoris 1996   9652781843
NA3770 .A46\1979 \Folio\ Alföldi, Andreas, 1895-1981 Aion in Mérida und Aphrodisias 1979 82460435 3805303939
NA3770.S87 1998 (ICU JRL Gen) Muth, Susanne Erleben von Raum, Leben im Raum : zur Funktion mythologischer Mosaikbilder in der römisch-kaiserzeitlichen Wohnarchitektur 1998   3980464865
NA5065 C37 1981 Carli, Enzo, 1910- pulpito interno della cattedrale di Prato 1981  
NA5620.S975 F477 1990 Ferrua, Antonio Basilica e la catacomba di S. Sebastiano 1990  
NA6141 .C17 Calza, Guido, 1888-1946 Necropoli del Porto di Roma nell' isola Sacra 1940 42051130  
NA737.W59 A3 (ARCH) NA737.W59 A3 White, Stanford, 1853-1906 Sketches and designs by Stanford White 1920 20018155 //r78  
NA737\.C29 C87x\1993 \Quarto\ Curran, Kathleen A Forgotten architect of the gilded age : Josiah Cleaveland Cady's legacy : [exhibition catalog] 1993  
NA9108 .A545 no.495/496 (NNU NYU Bobst) Kelly, Eric D "Everything you always wanted to know about regulating sex businesses" c2000   1884829481
NA9355.P6K35 1998 (ICU JRL Gen)   Kaiser-Wilhelm-Denkmal, 1896-1996 : Öffentlichkeit und Politik zwischen Tradition und Moderne 1998 99200998 3895342122
NA997.J7 S8 (MAIN) Strong, Roy C Britannia triumphans : Inigo Jones, Rubens and Whitehall Palace c1980 80052042  
NB115 .P74 2001 (NjP sa) NB115 .P74 2001 (NjP anxa) Princeton University. Art Museum Roman sculpture in the Art Museum, Princeton University c2001   0943012341
NB1265 .B66x (P) Bonghi Jovino, Maria Terrecotte votive; catalogo del Museo provinciale campano [1965- 68120922//r78 8822238265
NB1280 .S3 (P) Sadurska, Anna Tables iliaques 1964 66080102  
NB1309.M37 1983 (ICU JRL Gen) Meriçboyu, Yildiz Istanbul Arkeoloji Müzesindeki büst seklinde kantar agirliklari = Steelyard weights in the form of busts in the Archaeological Museum of Istanbul 1983  
NB164 .P6 (HIS) Poulsen, Frederick, 1876- Greek and Roman portraits in English country houses 1923 24011040  
NB1950 A236\1993\(LC)   Acanthe dans la sculpture monumentale de l'antiquité à la Renaissance 1993   2735502805
NB237\.E2 A4\1980 Eberle, Abastenia St. Leger, 1878- Abastenia St. Leger Eberle, sculptor (1878-1942) : Des Moines Art Center, July 15-August 17, 1980 c1980 80066884  
NB85 .C82 (SA) NB85 .C79 1951 Ny Carlsberg glyptotek Catalogue of ancient sculpture in the Ny Carlsberg Glyptotek 1951  
NB87 .B65 1925 (HIS) Museum of Fine Arts, Boston Catalogue of Greek and Roman sculpture 1925 25005089  
NB91.P4P47 1996 (ICU JRL Gen)   Pergamon : the Telephos frieze from the Great Altar c1996-1997 95083343 0884010899
NC1766\J3 N37X\2001\(LC) Napier, Susan Jolliffe Anime from Akira to Princess Mononoke : experiencing contemporary Japanese animation 2001 00051473 0312238622
NC1766\J3 P65X\1999\(LC) Poitras, Gilles Anime companion : what's Japanese in Japanese animation? 1999 98044487 1880656329
NC795 .L4 1993 (BMAIN) Leslie, Clare Walker Art of field sketching 1993 92040243 0879055553
Nc92\861eb   Eighty years' progress of the United States from Revolutionary War to the great rebellion, showing the various channels of industry through which the people of the United States have arisen from a British colony to their present national importance . 1864  
Nc95\R9\927Av Arlamowski, Kazimierz Zapatrywania i dazenia gospodarcze szlachty czerwonoruskiej w XVII wieku 1927 67043377  
NC997.A4 E86 1984   Ethnic images in advertising c1984  
ND 623 .G3646 A4 1999 (LEE)   Orazio Gentileschi at the court of Charles I 1999 gb 99022102 8487184502
ND\3161\.V54 M56\1986   Miniatura veronese del Rinascimento 1986  
ND\623\.G333 A4\1999   Orazio Gentileschi at the court of Charles I 1999   8487184502
ND1130 .H5613 1979 (FINE) Hollanda, Francisco de, 1517-1584 Four dialogues on painting [1979] 78020470 0883558483
ND1329 .S29 A4 1999 F (CSt ART STACKS) Saville, Jenny 1970- Jenny Saville : territories c1999]  
ND1359.3 .S83 2001 (PU fine)   Holland frozen in time : the Dutch winter landscape in the golden age 2001   9040095760
ND190 .B6 (P) Blanche, Jacques Émile, 1861-1942 Propos de peintre : de David à Dégas 1919  
ND212 .C63x\1993 \folio\ Exhibition of Contemporary American Painting (43rd : 1993 : Corcoran Gallery of Art) 43 : 43rd Biennial Exhibition of Contemporary American Painting 1993 93079576 0886750407
ND237.B97 M12 McCausland, Elizabeth, 1899-1965 David Burliuk: 55 years of painting [1962]  
ND237.K83 A4 1982 (EAST)   Amerika ni mananda Nihon no gakatachi : Kuniyoshi, Shimizu, Ishigaki, Noda to Amerikan shin kaiga = Japanese artists who studied in U.S.A. and the American scene c1982  
ND237.K83 W65 1993 (MA) Wolf, Tom Yasuo Kuniyoshi's women 1993 93004337 1566403200
ND237.R13 A4 1999 RANGER HENRY Becker, Jack Henry Ward Ranger and the humanized landscape / by Jack Becker ; with an essay by Lance Mayer and Gay Myers c1999   1880897199
ND237\.C66 A2\1991\VTN910   Robert Colescott interview [videorecording] 1991  
ND2757.A75 D35 1997 (ICU jrl Gen) Dale, Thomas E. A., 1961- Relics, prayer, and politics in medieval Venetia : Romanesque painting in the crypt of Aquileia Cathedral c1997 97000386 0691011753
ND2895.P5A5 (ICU JRL Gen) Pierpont Morgan Library Glazier Collection of Illuminated Manuscripts 1968 68017003 //r85  
ND3161.V4 M3 (FINE) Mariani Canova, Giordana Miniatura veneta del Rinascimento, 1450-1500 [1969] 79495239  
ND456 .B79 1997 Burke, Marcus B Collections of paintings in Madrid, 1601-1755 c1997 97021522 0892364963
ND465 .S76\1995 Strong, Roy C Tudor and Stuart monarchy : pageantry, painting, iconography 1995-1998 94040082 085115400X
ND547 .K47 1996b (MAIN) Kessler, Marni Reva Sheer material presence, or, The veil in late nineteenth-century French avant-garde painting 1996  
ND547.5.I4 R84 1999 Rubin, James Henry Impressionism 1999   0714838268
ND547.P457 1997 (ICU JRL Gen)   Peintres français et l'Espagne : de Delacroix à Manet : Musée Goya - Castres, 11-juillet-5 octobre 1997 1997   2901643272
ND553.P47 S22 (ART) Sanouillet, Michel Françis Picabia et "391" [i.e. Trois cent quatre-vingt-onze] 1960-  
ND615 .P54 1987   Pittura in Italia : il Quattrocento 1987, c1986  
ND616 .L4 Levey, Michael Later Italian pictures in the collection of Her Majesty the Queen [1964]  
ND616 .L4 Q Levey, Michael Later Italian pictures in the collection of Her Majesty the Queen [1964] 64054941  
ND621 .V5\B67 Bonicatti, Maurizio Aspetti dell'umanesimo nella pittura veneta dal 1455 al 1515 [1964] 66059891  
ND621.F4 B35 1994 (NNU Bobst) ND621.F4 B35 1994 (NNU Bobst) Ballarin, Alessandro Dosso Dossi : la pittura a Ferrara negli anni del ducato di Alfonso I [1994]-[1995] 96110357  
ND621.N2P352 1958 (ICU JRL Gen) Palazzo Barberini (Rome, Italy) Pittori Napoletani del '600 e del '700. Quarta esposizione temporanea della Pittura Seicentesche e Settecentesche della Galleria Nazionale [held from] April-Maggio 1958 [1958]  
ND621.N2P480 1985 (ICU JRL Gen)   Pintura napolitana de Caravaggio a Giordano : Palacio de Villahermosa, octubre/diciembre 1985, Museo del Prado [1985?] 87109209 8450521610
ND623.B39A683 1985 (ICU JRL Gen) Belting, Hans Giovanni Bellini, Pietà : Ikone und Bilderzählung in der venezianischen Malerei 1985 85202628 3596239273
ND623.C218 F82 Franco Fiorio, Maria Teresa Giovan Francesco Caroto 1971 72325757  
ND623.V5 H33 Hadeln, Detlev, Freiherr von, 1878-1935 Paolo Veronese 1978  
ND623\.B23 G56x\1991 \Quarto\ Giornata di studi guerciniani (1991 : Cento, Italy) Giornata di studi Guerciniani, 19 Ottobre, 1991, Cento 1991  
ND673.R82 A75\1983 Brown, Christopher, 1948- Rubens, Samson and Delilah c1983   0901791857
ND688.F88 2000 (ICU JRL Gen)   Futurismus in Russland und David Burliuk, "Vater des russischen Futurismus" : Staatliches Russisches Museum ; Von der Heydt-Museum Wuppertal und Kunst- und Museumsverein Wuppertal 2000 00435535 3930775913
ND699.B95A4 1994 (ICU JRL Gen) Burliuk, David, 1882-1967 David Burliuk : faktura i tsvet : proizvedeniia Davida Burliuka v muzeiakh rossiiskoi povintsii 1994  
ND699.B96 G62 \+\ Gollerbach, Erikh Fedorovich, 1895 Iskusstvo Davida D. Burliuka. Art of David Burliuk 1930  
ND804 .C25 (NjP SA) Carducci, Vincenzio, 1578-1638 Diálogos de la pintura 1865  
ND811.S5 V34 (ART) Valdivieso, Enrique Catálogo de las pinturas de la Catedral de Sevilla 1978 79385634 8440042043
ND812.V6 (ICU JRL Gen) Viardot, Louis, 1800-1883 Notices sur les principaux peintres de l'Espagne 1839  
Ndq51\908B Bouglé, Célestin Charles Alfred, 1870-1940 Syndicalisme et démocratie : impressions et réflexions 1908  
Ndt31\U2\+949b Bureau of National Affairs (Washington, D.C.) Negotiated pension plans; text of 30 agreements with editorial summary 1949, c1950] 50006295  
Ndv53\F6\908j Jeanneney, Jules Émile, 1864- Associations et syndicats de fonctionnaires; étude législative 1908 12006675  
NE\647\.6\.P6 I88\1998 Ittmann, John W Post-impressionist prints : Paris in the 1890s 1998 97048844 0876331193
NE539.K86 A4 1991 f Davis, Richard A Yasuo Kuniyoshi : the complete graphic work 1991   1556600895
Newspapers No call number (olin)   Atlanta constitution    
Nfd10\1\1933 Peil', V. A Novaia epokha: ideokratiia; politika-ekonomika; obzory 1933  
NJ18\B265 S65\FLE\6612\1991A\(LC) Solberg, Gail E Taddeo di Bartolo : his life and work c1991  
NJ18\F717 +L57\FKW\2557\1996\(LC) Harrison, Martin, 1945- Lisa Fonssagrives : three decades of classic fashion photography 1996 96018030 0865659788
NK1068 .H65x\1997 \Quarto\ Howard, David Sanctuary Tale of three cities : Canton, Shanghai & Hong Kong : three centuries of Sino-British trade in the decorative arts 1997]  
NK1442 +J313 (LC) (ART) Jarry, Madeleine Chinoiserie : Chinese influence on European decorative art 17th and 18th centuries c1981 81010321 0865650187
NK1476.A1 H89 1994 Oversize (NNU NYU Bobst) NK1476.A1 H89 1994 (NNNS NSSR Parsons) Huyler, Stephen P., 1951- Painted prayers : women's art in village India c1994 93049404 0847818098
NK1678.V66 P65 1997 (P) Polk, Patrick Arthur Haitian Vodou flags c1997 97014002 1578060249
NK3665 .R45 1991x (MH Harvard Depository) Reitzenstein, Dagmar von Privatreliquiare des frühen Mittelalters 1991  
NK4390 .P56x\1997 \Quarto\ Pinot de Villechenon, Marie Noëlle Sèvres : porcelain from the Sèvres Museum, 1740 to the present day c1997   0853316899
NK4567.5 .A97 1990 (ARTL) Ayers, John Porcelain for palaces : the fashion for Japan in Europe, 1650-1750 c1990 90060779 0903421240
NK4623.M37 G7 1983 (P)   Greek vases in the J. Paul Getty Museum 1983- 82049024 0892360585
NK4645 +A84\1997\(LC)   Athenian potters and painters : the conference proceedings 1997   1900188120
NK5107 .V37 1959 (ARTL) Biblioteca apostolica vaticana. Museo sacro Gold-glass collection of the Vatican Library : with additonal catalogues of other gold-glass collections 1959  
NK5860 .M3 (HIS) Marangou, Evangelia-Lila I Lakonische Elfenbein- und Beinschnitzerein (1969) 74581175  
NK6196 .L53 1984 (NNU Bobst)   Lighting in America : from colonial rushlights to Victorian chandeliers 1984 84000897 0915590409
NK7198 V65Z3 (MAIN)   Zeldzaam zilver uit de gouden eeuw : de Utrechtse edelsmeden Van Vianen : [tentoonstelling] Centraal Museum Utrecht, 14 december 1984 t/m 10 februari 1985 1984  
NK7303.B47 I53 ((FTaSU) main) Indiana University. Museum of Art Ancient jewelry from the collection of Burton Y. Berry 1973]  
NK8804 .P49 Pfister, R Textiles de Palmyre découverts par le Service des antiquités du Haut-commissariat de la République française dans la nécropole de Palmyre 1934- 35010660  
NK8884.A1M37   Shosoin gire to Asuka Tempyo no senshoku = Jodai-gire : 7th and 8th century textiles in Japan from the Shoso-in and Horyu-ji 1984   4879400122
NK9698.A83 A8 Aycock, Alice Project entitled "The beginnings of a complex ... " (1976-77) : notes, drawings, photographs c1977 77084885 0093078059
no. 000185 \*ZAN-3020 Norat Martínez, José, ed Historia del Regimiento 65 de Infantería, 1899-1960 1960  
no. 000459 \*ZAN-3020 Burgos, Julia de, 1914- Mar y tú, otros poemas 1954  
Non-circulating (NNNS NSSR NewSchool Microform) Non-circulating (NNNS NSSR NewSchool Thesis) Pisani, Shelden Ogilvy Codependence, field dependence and intimacy in the context of addiction : a study of mobility in personality and cognitive styles with recovering alcoholics/addicts and controls c1999  
Non-circulating (NNNS NSSR NewSchool Microform) Non-circulating (NNNS NSSR NewSchool Thesis) Richardson, Laura Social network characteristics and substance abuse treatment outcome 1999  
Non-circulating BL820.V5 S35 1982 (NNU IFA) BL820.V5 S35 1982 (NNU Bobst) BL820.V5 S35 1982 (NNU Bobst) BL820.V5 S35 1982 (NNU Bobst) (NNU Bobst) Schilling, Robert, 1913- Religion romaine de Vénus : depuis les origines jusqu'au temps d'Auguste 1982  
Non-circulating LD3907.E3 1988 .G82 (NNU Bobst Microform) LD3907.E3 1988 .G82 (NNU Bobst) Guirguis, Sonia A Image of Egypt in The New York times, 1956, 1967, 1979 1988  
Non-circulating LD3907.E3 1998 .Y86 (NNU Bobst Microform) LD3907.E3 1998 .Y86 (NNU Bobst) Yun, Elise Hae-Ryung Alexander Scriabin's late piano poems : language, thought and performance c1998  
Non-circulating LD3907.G7 1992 .K75 (NNU Bobst Microform) LD3907.G7 1992 .K75 (NNU Bobst) Krupnick, Robert N Commitments to multiple work and nonwork identities : an investigation of interrelationships and effects on work and family performance 1992  
Non-circulating LD3907.G7 1995 .R45 (NNU Bobst Microform) LD3907.G7 1995 .R45 (NNU Bobst) Reichl, Alexander J Politics and culture in urban development : the reconstruction of Times Square c1995  
Non-circulating LD3907.G7 1996 .E87 (NNU Bobst Microform) LD3907.G7 1996 .E87 (NNU Bobst) Ezra, Karen Roth Analysis of treatment preferences in patients of a late life depression clinic c1996  
Non-circulating LD3907.G7 1996 .E87 (NNU Bobst Microform) LD3907.G7 1996 .E87 (NNU Bobst) Ezra, Karen Roth Analysis of treatment preferences in patients of a late life depression clinic c1996  
Non-circulating LD3907.S3 1997 .L38 (NNU Bobst Microform) LD3907.S3 1997 .L38 (NNU Bobst) Laudante, Lisa M Self-image and self-esteem of female adolescents who engage in disturbed eating and the practice of unsafe sex c1997  
none   Organic geochemistry    
NX170 .P46 1994 (CSt SAL STACKS)   Pensée de l'image : signification et figuration dans le texte et dans la peinture c1994 95180867  
NX180.S6 R44x 1990 (P)   Reimaging America : the arts of social change c1990   0865711690
NX456.5 .D3 B47 2000 (CSt GREEN STACKS) Bergius, Hanne Montage und Metamechanik : Dada Berlin - Artistik von Polaritäten 2000   3786115257
NX549.A1 R5 1993 (P) Ribner, Jonathan P Broken tablets : the cult of the law in French art from David to Delacroix c1993 92023046 0520077490
NX571.U474B876 1993 (ICU JRL Gen) Noha, Oles', 1959- Davyd Burliuk i mystetstvo vsesvitn'oho avanhardu 1993  
NX650.M48 B37 1986 (P) Barkan, Leonard Gods made flesh : metamorphosis and the pursuit of paganism c1986 86001325 0300035616
NX650.R25 P75 1989 (LC) (ART)   Prisoners of image : ethnic and gender stereotypes : January 7-March 4, 1989, Alternative Museum, New York c1989 88084137 093207524X
NX652.H38H473 1997 (ICU JRL Gen)   Héra : images, espaces, cultes : actes du colloque international 1997   2903189544
Ocg75\H129\964 Halbecq, Michel État : son autorité, son pouvoir, 1880-1962 1964  
ON ORDER\/ IN PROCESS   Hindi stories = Hindi kahaniyam : a dual language reader for area and advanced students 1975  
Oversize E97.6.C2 P91 + (olin) Pratt, Richard Henry, 1840-1924 Battlefield and classroom 1964 64020931  
Oversize JK31 .D43x 1998 + (olin)   Deconstructing distrust : how Americans view government [1998] 98145116  
Oversize Q171 .G685x 2000 + (olin) Gould, Stephen Jay Crossing over : where art and science meet c2000 99058304 060980586X
P 87/1502 (Bibliothèque Nationale HS) Cecco d'Ascoli, (pseud.) Acerba 1927  
P\299\Q3\S93x\1993 Swart, Henriëtte de, 1961- Adverbs of quantification : a generalized quantifier approach 1993 93006928 0815314302
P\85.\B16 B16   Bakhtin, essays and dialogues on his work 1986 85024624 0226541339
P\85\.B16 U58\1994 Universidad Nacional de Educación a Distancia. Instituto de Semiótica Literaria y Teatral. Seminario Internacional (4th : 1994 : Madrid, Spain) Bajtín y la literatura : actas del IV Seminario Internacional del Insitituto de Semiótica Literaria y Teatral, Madrid, UNED, 4-6 de julio, 1994 1995 95197989 8475224725
P1 .S78+   Working papers on language universals   75644587  
P1 .U58 University of Massachusetts occasional papers in linguistics (1978) University of Massachusetts occasional papers in linguistics 1978-  
P118 .P484 1992 (F)   Phonological development : models, research, implications c1992 92001152 0912752246
P118 B469X\1998\(LC) Bernhardt, Barbara Handford Handbook of phonological development from the perspective of constraint-based nonlinear phonology c1998 97080298 0120928302
P118.2 .E39 1991 (F) (SW) Ellis, Rod Second language acquisition & language pedagogy c1992 91032201 185359136X
P118.2 .H47 2000 (PU vanp) Herschensohn, Julia Rogers, 1945- Second time around : minimalism and L2 acquisition c2000 99058276 9027224897
P118.2 .H47 2000 (PU vanp) Herschensohn, Julia Rogers, 1945- Second time around : minimalism and L2 acquisition c2000 99058276 9027224897
P118.2 .L53x\1996 Liceras, Juana M Adquisición de las lenguas segundas y la gramática universal [1996]   8477383871
P118.2 .V94 1994 (F)   Vygotskian approaches to second language research c1994 93049680 1567500242
P118.2 A33X\1992\(LC)   Adquisición de las lenguas extranjeras : hacia un modelo de análisis de la interlengua c1992 93248099 8477748640
P128.C37Y665 1992 (ICU JRL Gen) Yoon, Hang-Jin Functional categories and complementation : in English, Korean and Turkish 1992  
P155\.B52 Bidwell, Annie E. Kennedy Dear General : the private letters of Annie E. Kennedy and John Bidwell, 1866-1868 1993, c1994 93074235  
P158 W29\1997\(LC)   Ways of scope taking c1997   0792344464
P158.5 .D6 (F) Dowty, David R Introduction to Montague semantics c1981 80020267 9027711410
P161 .M66x\1988 Moortgat, Michael Categorial investigations : logical and linguistic aspects of the Lambek calculus 1988   906765387X
P161 .M67 1994 Morrill, Glyn V Type logical grammar : categorial logic of signs c1994 94033169 0792330951
P161 .M67 1994 Morrill, Glyn V Type logical grammar : categorial logic of signs c1994 94033169 0792330951
P161 .M67\1994 Morrill, Glyn V Type logical grammar : categorial logic of signs c1994 94033169 0792330951
P165 D57X\1997\(LC)   Discourse and perspective in cognitive linguistics c1997 97039411 9027236550
P204.S9 (GLX) (BUR) (BAR)   Syntactic typology : studies in the phenomenology of language c1978 78056377 0292775458
P21 .C635 1998 (PU vanp) Congreso Nacional de Investigaciones Lingüístico-Filológicas (2nd : 1998 : Universidad Ricardo Palma) Actas del II Congreso Nacional de Investigaciones Lingüístico-Filológicas 1998 00271083  
P21 .I58 1962 (GLX) \408\ J266\v.12 (BAR) International Congress of Linguists, 9th, Cambridge, Mass, 1962 Proceedings of the ninth International Congress of Linguists, Cambridge, Mass., August 27-31, 1962 1964  
P21 .L752 (olin)   Linguistics in the Netherlands   88640603  
P21 .M53 1983 (STK) Mid-America Linguistics Conference (18th : 1983 : Boulder, Colo.) 1983 Mid-America Linguistics Conference papers 1984  
P217 .D47 1997   Derivations and constraints in phonology 1997 96053307 0198236905
P217 .S298 1997 (NNU Bobst) Scobbie, James M Autosegmental representation in a declarative constraint-based framework 1997 97017752 0815329490
P222 .B6 (VPL) Bolinger, Dwight Le Merton, 1907- comp Intonation: selected readings 1972 73331259 0140806636
P224 .W67 1999   Word prosodic systems in the languages of Europe 1999 99018081 3110157500
P224 .W67\1999   Word prosodic systems in the languages of Europe 1999 99018081 3110157500
P23 .M25 1976 (VPL) MSSB-UC Irvine Conference on the Formal Syntax of Natural Language, Newport Beach, Calif., 1976 Formal syntax 1977 76058854 0121992403
P231 .H35 1987 (F) Halle, Morris Essay on stress c1987 87003613 0262081687
P231 .P37x 1979 (F)   Papers on syllable structure, metrical structure, and harmony processes [1979?] 89139541  
P231 .S9 1976 (VPL) Symposium on Stress and Accent, University of Southern California, Los Angeles, 1976 Studies in stress and accent 1977  
P241 .M598\1995   Morphological aspects of language processing 1995 94028968 0805813586
P25 .S96x\v.3   Speech acts [c1975]  
P26.D54 U637 1990g   Unity in diversity : papers presented to Simon C. Dik on his 50th birthday 1990   9067655112
P271 H66X\1996\(LC) Hoop, Helen de, 1964- Case configuration and noun phrase interpretation 1996 96021117 0815325606
P271 H66X\1996\(LC) Hoop, Helen de, 1964- Case configuration and noun phrase interpretation 1996 96021117 0815325606
P273 W48X\1996\(LC) Wetzer, Harrie, 1956- Typology of adjectival predication 1996 96025144 3110149893
P291 .S38 1992   Satz und Illokution 1992- 92236526//r93 348430278X
P291.5 .E7 (LC) (S)   Ergativity : towards a theory of grammatical relations 1979 78073889 0125581505
P297 .C48   Chicago which hunt: papers from the Relative Clause Festival, April 13, 1972; a paravolume to Papers from the eighth regional meeting [1972] 73150442  
P299 .Q3 F567 1994B (CSt GREEN STACKS) Fintel, Kai von Restrictions on quantifier domains c1994  
P299.Q3 D64 1997 ((FU) main) Doetjes, Jenny Sandra, 1965- Quantifiers and selection : on the distribution of quantifying expressions in French, Dutch and English c1997   9055690341
P302 .D564x 1999 (olin)   Discourse reader 1999 98032357 0415197333
P302 .L587 1999 (CSt GREEN STACKS)   Logical relations in discourse c1999 98061616 1556710402
P302 .S726 1998 Stillar, Glenn F Analyzing everyday texts : discoure, rhetoric, and social perspectives c1998 97033815 0761900608
P302 D5488X\1996\(LC)   Discourse in society : systemic functional perspectives 1995   1567500439
P302 G4X\1999\(LC) Gee, James Paul Introduction to discourse analysis : theory and method 1999 98054719 0415211867
P306 P68\1998\(LC)   Practices of literary translation : constraints and creativity 1998, c1999   1900650193
P306.A1 A53 vol.10 (NNU NYU Bobst)   Translation and medicine 1998   9027231850
P325 .C324 1997 (ICU JRL Gen) Carpenter, Bob Type-logical semantics 1998 97000863 0262032481
P325 .S96\1990 Sweetser, Eve From etymology to pragmatics : metaphorical and cultural aspects of semantic structure 1990 89007320 0521324068
P35.5.P7 H36 1996 (NNU Bobst) Hannan, Kevin, 1954- Borders of language and identity in Teschen Silesia 1996 96019239 0820433659
P381.A75 P48 1997   Phonologies of Asia and Africa : : (including the Caucasus) 1997 97004964 1575060175
P40 .S5444 1996   Social interaction, social context, and language : essays in honor of Susan Ervin-Tripp 1996 96018567 0805814981
P49 .T76 1984 (F)   Tropic crucible : self and theory in language and literature [c1984] 85940633 9971690837
P512.P84 S78 1997g   Studies in honor of Jaan Puhvel c1997   0941694542
P53 .L35 1991   Language awareness in the classroom 1991 90019557 0582067375
P85.B22 B35 1986 (VPL)   Bakhtin, essays and dialogues on his work 1986 85024624 0226541339
P85.T78 N2 1993   N.S. Trubetskoi i sovremennaia filologiia 1993   5201132049
P90 .F64 1985 (BAKR) \\oversize\   Foreign news in the media : international reporting in 29 countries c1985   9232022656
P91 .I56 1990 (F)   Intentions in communication c1990 89012759 0262031507
P93.5 .R67 2001 (NNU NYU Bobst) Rose, Gillian Visual methodologies : an introduction to the interpretation of visual materials c2001   0761966641
P95.8 .A44 1996b (BAKR) Alger, Dean Media and politics c1996 95020843 0534236944
P99 .I57\1994 International Association for Semiotic Studies. Congress (5th : 1994 : University of California, Berkeley) Semiotics around the world : synthesis in diversity : proceedings of the Fifth Congress of the International Association for Semiotic Studies, Berkeley, 1994 1997 96003093 3110122235
P99 .S484 1984 (P)   Sign, system, and function : papers of the first and second Polish-American semiotics colloquia c1984 84003288 9027932700
PA1061 .T48 1998   Themes in Greek Linguistics II 1998 98006207 1556198752
PA1091 .S78 1999 (NNU Bobst)   Studies in Greek syntax c1999 98039985 0792352904
PA2080.J64 1998 (ICU JRL Gen) Johnston, Patricia A Traditio : an introduction to the Latin language and its influence c1998   0941051765
PA2087 .H57 1982g Hillard, A. E. (Albert Ernest), 1865-1935 Elementary Latin exercises : an introduction to North and Hillard's Latin prose composition 1989 89002611 0893415693
PA2087.5 .W55 1995 (olin) Wilding, L. A. (Longworth Allen), 1902- Latin course for schools 1995-1996   0715626744
PA227 .H76 1997 Horrocks, Geoffrey C Greek : a history of the language and its speakers 1997   0582307090
PA3113 .B38 1993 Bartol, Krystyna Greek elegy and iambus : studies in ancient literary sources 1993   8323205299
PA3113 .W4 West, Martin Litchfield Studies in Greek elegy and iambus 1974 73093168 3110045850
PA3445\D5 S88\1989 Sutton, Dana Ferrin Dithyrambographi Graeci c1989 89213456 361500034X
PA3457 P4 1988 Peek, Werner, 1904- Greek verse inscriptions : epigrams on funerary stelae and monuments = Griechische Vers-Inschriften : Grab-Epigramme 1988   0890054797
PA3457 P4 1988 Peek, Werner, 1904- Greek verse inscriptions : epigrams on funerary stelae and monuments = Griechische Vers-Inschriften : Grab-Epigramme 1988   0890054797
PA3825\A6 V367\1991 Vellacott, Philip English reader's guide to Aeschylus' Oresteia 1991-1993   0951827006
PA4013.H6 C83 1983 Cuffari, Giuseppa Riferimenti poetici di Imerio 1983  
PA4037 .A59 1995 (P)   Ages of Homer : a tribute to Emily Townsend Vermeule 1995 94013817 0292711697
PA4369.A73 P45 1988 Plutarch Life of Antony 1988 87003004 0521240662
PA4382 .J6 (HIS) Jones, Roger Miller Platonism of Plutarch .. 1916 16015075  
PA4399\P15 +B37\2001 Posidippus, of Pella, b. ca. 310 B.C Epigrammi : P. Mil. Vogl. 8. 309 c2001   8879161652
PA4411\Z5 P65\1995 Poltera, Orlando Langage de Simonide : étude sur la tradition poétique et son renouvellement c1997 97169889 3906757323
PA4413.A7 B46 1998 (P) Benardete, Seth Sacred transgressions : a reading of Sophocles' Antigone 1999 98006763 1890318779
PA4413.O7 V39 1993 (PU vanp) Vellacott, Philip English reader's guide to Sophocles' Oedipus Tyrannus and Oedipus Coloneus 1993 94143611 0951827014
PA4446 .A2 1978 Theognis Theognidis et Phocylidis fragmenta et adespota quaedam gnomica 1978   3110077647
PA4488 1903 (P) Wilamowitz-Moellendorff, Ulrich von Timotheos : die Perser aus einem Papyrus von Abusir im auftrage der Deutschen orientgesellschaft, hrsg. von Ulrich von Wilamowitz-Mollendorff .. 1903  
PA5610.K39 S7313 (CRO) Kazantzakis, Nikos, 1883-1957 At the palaces of Knossos : a novel 1987 87024762 0821408798
PA6207 .M33 2000 (PU vanp) Apuleius Apuleius Madaurensis Metamorphoses. Book X 2000   9069801280
PA6482 .A3 1984 (MAIN) Lucretius Carus, Titus De rerum natura I c1984   0862920760
PA6519 .M4 1985 (LC) (S) PA6519 .M4 1985 (CLA) Ovid, 43 B.C.-17 or 18 Metamorphoses I-IV c1985   085668256X
PA6519.M5 M87 2000 (NNU NYU Bobst) Ovid, 43 B.C.-17 or 18 A.D Student's Ovid : selections from the Metamorphoses c2000 99045081 0806132191
PA6519.M6 A1 1984 Ovid, 43 B.C.-17 or 18 A.D Metamorphoses I 1984, c1953  
PA6519.M9 L38 1998 (ICU JRL Gen)   Latin commentaries on Ovid from the Renaissance c1998 98046745 1893009025
PA6522.M2 H543 1999 (PU vanp) Ovid, 43 B.C.-17 or 18 A.D Metamorphoses IX-XII c1999   0856686468
PA6522.M2 H55 1992 Ovid, 43 B.C.-17 or 18 A.D Metamorphoses V-VIII c1992 94165004 0856683949
PA6648\P6 P477X\1993 Roberts, Michael John, 1947- Poetry and the cult of the martyrs : the Liber peristephanon of Prudentius c1993 93031245 0472104497
PA6801.A3 H3 1952 ((FTaSU) main,hum) PA6801.A3 H3 1952 ((FTaSU) main) Virgil Works of P. Virgilius Maro, including the Aeneid, Bucolics and Georgics, with the oringinal text, and an interlinear translation. Adapted to the system of classical instruction, combining the methods of Ascham, Milton, and Locke [1952]  
PA6801.A6F9 1883 (ICU JRL Gen) Virgil Twelve books of the Aeneid [c1883]  
PA6802.A1 P5 1964 Vergilius Maro, Publius Aeneid : books I-VI [1966,c1964] 64002058  
PA6802.A1 P5 1964 Vergilius Maro, Publius Aeneid : books I-VI [1966,c1964] 64002058  
PA6803.B32 M34x 1992 (olin) Virgil Virgil, Aeneid, Book XII 1992 gb 93027818 1853992445
PA6807.A3 F3 2000g Virgil Aeneid, 7-12 ; appendix Vergiliana 2000   0674995864
PA6807.A5 M31 1901 Virgil Aeneid of Virgil : being the Latin text in the original order, with the scansion indicated graphically, with a literal interlinear translation and with an elegant translation in the margin and footnotes in which every word is completely parsed, the c c1901  
PA6807\.A5 H57\2000 Virgil Virgil, Aeneid 7 : a commentary 2000 99037197 9004108424
PA6807\A5 D39\Suppl Williams, R. D. (Robert Deryck), 1917- Aeneid of Virgil : a companion to the translation of C. Day Lewis, with introduction, commentary & glossary 1985   0862920442
PA8079 .S374 2001 (NNU NYU Bobst)   Sapere delle parole : studî sul dialogo latino e italiano del Rinascimento : giornate di studio, Anversa, 21-22 febbraio 1997 c2001   8883196007
PA8250 A3\1992 Archipoeta, fl. 1140-1165 Archipoeta : Lateinisch und Deutsch c1992 92247958 3050021578
PA8570.R44 A7\1970 Reuchlin, Johann, 1455-1522 Henno. Komödie. Latein. u. dt [1970] 76157203  
Pamphlet\FL\Argentina\198 Santos, Cloe de los Mujer argentina en la época de la emancipación 1931  
PB12.C2 v.21 no.6 (ICU JRL Gen) Walpole, Ronald N. (Ronald Noel), 1903- Charlemagne and Roland; a study of the source of two Middle English metrical romances, Roland and Vernagu and Otuel and Roland 1944 a 44000928  
PB35 .C85\1994   Culture and language learning in higher education c1994 93050831 //r94 1853592285
PC153 .F37 1985 (VPL) Farkas, Donka Intensional descriptions and the romance subjunctive mood 1985 85015854 0824054261
PC1683.B9E3 (ICU JRL Gen) Edler, Florence Marguerite Glossary of mediaeval terms of business, Italian series, 1200-1600 1934 34038360  
PC201 .B47 1993A (CSt GREEN STACKS) Bernstein, Judy B Topics in the syntax of nominal structure across Romance 1995, c1993  
PC2942 .D43 1999 (PU vanp) Dean, Ruth J Anglo-Norman literature : a guide to texts and manuscripts 1999   0905474384
PC320 .D8 1993 (CSt GREEN STACKS)   Du lexique à la morphologie : du côté de chez Zwaan : textes réunis en l'honneur du soixantième anniversaire de Wiecher Zwanenburg 1993   9051836023
PC3911 .R44 1997 (NNU Bobst) Reguant, Montserrat, 1947- Etapas reivindicativas de la teoría nacional catalana : Verdaguer, Oller y Prat de la Riba c1997 95050423 0820430536
PC3941.S344 A25 1982 (S) Salvat-Papasseit, Joan, 1894-1924 Selected poems 1982 83212275 0950713716
PC4117 .T4 1868 (MAIN)   Tesoro de las niñas : colección de artículos estractados y traducidos de los mejores autores y publicada para servir de texto de lectura en los colegios y escuelas 1868  
PC4872 .A2 (VPL) Abad de Santillán, Diego Diccionario de argentinismos de ayer y de hoy 1976 77465028  
PE1068.I4\S34 1994   Second language acquisition : socio-cultural and linguistic aspects of English in India 1994 94904464 817036406X
PE1068.S7 C36 1999g Canagarajah, A. Suresh Resisting linguistic imperialism in English teaching 1999   0194421546
PE1083.R4 1985 (ICU JRL Gen)   Rhetoric and the pursuit of truth : language change in the seventeenth and eighteenth centuries : papers read at a Clark Library seminar, 8 March 1980 1985 86622068//r96  
PE1404 .N435 1998 (MASTK)   Negotiating academic literacies : teaching and learning across languages and cultures 1998 98013599 0805829989
PE1408 .B6988 Brooks, Cleanth, 1906- Fundamentals of good writing : a handbook of modern rhetoric [1950] 50007936  
PE1417 .R38 1992   Reading culture : contexts for critical reading and writing c1992 91026240 0673463133
PE1421 .W545\1989 Williams, Joseph M Style : ten lessons in clarity & grace c1989 88018548 0673381862
PE1505 O37X\1998 Oliver, Mary, 1935- Rules for the dance : a handbook for writing and reading metrical verse 1998 98002625 039585086X
PE26\.A46 I49x\1999   Intercultural encounters - studies in English literatures : essays presented to Rüdiger Ahrens on the occasion of his sixtieth birthday 1999   3825308499
PE3502.I6 A34 1997 (PU vanp) Agnihotri, Rama Kant, 1945- Problematizing English in India 1997 97007936 0803993757
PF3025 .S87\nr.41   Interfaces in phonology 1996   3050029641
PF3025 .S87\nr.41   Interfaces in phonology 1996   3050029641
PF3107 D48\2000   Deutsche Grammatik in Theorie und Praxis 2000 201329024 3484730536
PF3135.K545 2000 (ICU JRL Gen) Klein, Thomas B "Umlaut" in optimality theory : a comparative analysis of German and Chamorro 2000   3484304162
PF3315.S82 B87x 1984 (MAN) Buscha, Joachim Konjunktiv 1984  
PF3321.H36 1995 (ICU JRL Gen) Helbig, Gerhard Deutsche Partikeln--richtig gebraucht? 1995   3324006082
PG\3505\.I94 F65x\1994   Fol'klor i literatura Ivanovskogo kraia : stat'i, publikatsii, materialy 1994- 95175576 5230022531
PG1408.2.O75 S67 1982 (S) Sop, Ivan Istok u srpskoj knjizevnosti : sest pisaca--sest videnja 1982 83177468  
PG2925 .P68 1999g Potaennaia literatura: voprosy istorii i tipologii (1999 : Ivanovskii gosudarstvennyi universitet) Potaennaia literatura : issledovaniia i materialy 2000   5780701539
PG3095 .G37\1998 Gasperetti, David Wayne, 1952- Rise of the Russian novel : carnival, stylization, and mockery of the West c1998 97011768 0875802303
PG3476.A48 Z52 2000g Aminado, Don, ca. 1888-1957 Poezd na tret'em puti 2000   5264002746
PG3489.8\.E687 A27 1993 Yermakov, Oleg Afghan tales : stories from Russia's Vietnam c1993 92046348 0688123945
PG3512.U8E6 1930 (ICU JRL Gen) Burliuk, David Davidovich, 1882- Entelekhizm [1930]  
PH23.T340 1984 (ICU JRL Gen) Tagung für Uralische Phonologie (3rd : 1984 : Eisenstadt, Austria) Studien zur Phonologie und Morphonologie der uralischen Sprachen : Akten der dritten Tagung für Uralische Phonologie, Eisenstadt, 28. Juni-1. Juli 1984 1987 88186931 3853696805
PH706 .B495 (GL) Bergsland, Knut, 1914- Lappische Grammatik mit Lesestücken 1976   3447017392
PH706 .S26 1998 F (CSt GREEN STACKS) Sammallahti, Pekka Saami languages : an introduction c1998 00308815 8273743985
PH712 .H3 Hasselbrink, Gustav Alternative analyses of the phonemic system in central south-Lappish 1965 65063390  
PHOTO MONO / SENTIS Sentís, Marta, 1949- Marta Sentís : habitacions i migracions = habitaciones y migraciones : 10 de juny-25 de juliol de 1993, Sala Catalunya de la Fundació "la Caixa" ... Barcelona c1993   8476644116
PJ3002.Z5 L368 1987   Working with no data" : Semitic and Egyptian studies presented to Thomas O. Lambdin 1987 87030571 0931464358
PJ3771.G6 G55 1997   Gilgamesh : a reader c1997 97000708 0865163391
PJ4569 .L58 (MAIN) Lipsitz, Edmond Y Olam shalem = 'Olam shalem (romanized) : a program of independent study utilizing audiotutorial teaching methods ... c1979  
PJ5053.A27 Z7   Le-'Agnon shai 1958]  
PJ5208.A2 N38 1985 (HIS) Naveh, Joseph Amulets and magic bowls : Aramaic incantations of late antiquity c1985   9652235318
PJ5208.A5 N3 (BMAIN) Naveh, Joseph 'Al pesefas ve-'even : ha-ketovot ha-Aramiyot veha-'Ivriyot mi-vate ha-keneset ha-'atikim 1978 78951880  
PJ5208.A5 N321 \+\ Naveh, Joseph 'Al pesefas ve-even : ha-ketuvot ha-Aramiyot veha-'Ivriyot mi-bate ha-keneset ha-'atikim 738, 1978 78951880  
PJ6151.I1983 G85 1995g Gully, Adrian Grammar and semantics in medieval Arabic : a study of Ibn-Hisham's 'Mughni l-Labib' 1995 gb 95030196 0700703020
PJ6305 .C5 1967 (BAKR) Caspari, C. P. (Carl Paul), 1814-1892 Grammar of the Arabic language 1967 68075078  
PJ8417.A5 L58 2000 (HIS)   Literature of Al-Andalus 2000 00022599 0521471591
PK1718.C45 A26 1996g Cattopadhyaya, Saratcandra, 1876-1938 Devdas and other stories c1996 96906611 8174360301
PK1718.C45 S713 1945g Cattopadhyaya, Saratcandra, 1876-1938 Srikanta : the autobiography of a wanderer [1945]  
PK2095.M5 Z77 Nilsson, Usha Saksena, 1930- Mira Bai [1969] 70910119  
PK2182 .H54 1995   Hidden in the lute : an anthology of two centuries of Urdu literature 1995 95206870 1857541170
PK2198.H32 T8 Hasrat Dihlavi, d. 1791 Masnavi-yi Tuti namah [1962?] sa 67006117  
PK2198.H32 T8 Hasrat Dihlavi, d. 1791 Tuti namah [1962?] sa 67006117  
PK2907.R25 M36 1991   Many Ramayanas : the diversity of a narrative tradition in South Asia c1991 91007273 0520072812
PK2907.R25 M36 1991 (INDO)   Many Ramayanas : the diversity of a narrative tradition in South Asia c1991 91007273 0520072812
PK6423.K18 (ICU Harp Harp) Kamshad, H. (Hassan) Modern Persian prose literature 1966 66010041  
PK6495.N16 T9 1979 (VPL) Nakhshabi, Ziya al-Din, d. 1350 Kniga popugaia = (Tuti-name) 1979  
PK6550.T8F7 1934 (ICU JRL Gen) Tuti'namah Touti-nameh, ou, Les contes du perroquet de Ziay-ed-Din Nakhchabi, d'apres la rédaction de Mohammed Qaderi 1934 35014944  
PK6732 .B4 (VPL) Becka, Jirí Study in Pashto stress 1969 72504944//r84  
PK7025 .K38\1985 Kaula, Omakara Aina., 1941- Intensive course in Kashmiri : dialogues, drills, exercises, vocabulary, notes on grammar, and word index 1985 88902995  
PL 790 .S3 E5 1998 (LEE) Saigyo monogatari. English Tale of Saigyo = (Saigyo monogatari) 1998 97025714 0939512831
PL2333 .L5\1997 Li, Tien Writing in crisis : translation, genre and identity in modern Chinese poetry 1997  
PL248.N26Z5 S82 Sop, Ivan Nasredinove metamorfoze 1973 74970105  
PL2515 .C667   Contemporary Chinese women writers c1991-  
PL2515 .T362513 1987g (EAX) Tang tai nü tso chia tso p'in hsüan. English. Selections One half of the sky : selection from contemporary women writers of China 1987   0434640387
PL2629.E68 C65   Chugoku hiseki sokan 1987  
PL381 .K7 (MAIN) Krueger, John Richard, 1927- Chuvash manual : introduction, grammar, reader and vocabulary 1961 62062548 /L  
PL4389.N596 R7 Nguyên-phan-Long Roman de Mademoiselle Lys. (Journal d'une jeune fille Cochinchinoise moderne) 1921  
PL4780.4 .K8 Kutumbarayasarma, Bi. Vi., 1912- Andhra navala parinamamu 1971- 73903861 /SA  
PL4780.9.C294Z850 1982 (ICU JRL Gen) Ranganayakamma, Muppala Calam sahityam : konni prasanalu, javabulu, vyasalu 1982 82906300 /SA  
PL4780.9.K8C30 (ICU JRL Gen) Kutumba Rao, Kodavatiganti, 1907- Caduvu [1962] sa 64004012  
PL4780.9.S653A2S7 1983 (ICU JRL Gen) Sri Sri, 1910- New frontiers : selected renderings into English from the original Telugu poems 1983 85910333  
PL4780.9.V4 Z86 1993 (VPL) Subbaravu, Vavilala, 1940- Calangari kathanika sahityamu, anusilanamu 1993 93905273  
PL4780.9.V4 Z88 1990 (VPL) Sudarsanam, Ar. Es., 1927- Gudipati Venkata Calam 1990 90904308  
PL4780.9.V4Z950 1983 (ICU JRL Gen) Venkatesvararavu, Nimmagadda Calam smasana sahityam 1983 84901841/sa/r91  
PL5295 .T581 (GL) Topping, Donald M Chamorro reference grammar [c1973] 72098012 0824802691
PL538.C6 T344 1991 (GEST)   Talking business in Japanese 1991   4789005968
PL579 .D68 1996 Downing, Pamela Numeral classifier systems : the case of Japanese c1996 96009444 155619370X
PL579 .D68\1996 Downing, Pamela Numeral classifier systems : the case of Japanese 1996 96009444 155619370X
PL580 .D68x ((FU) main) Downing, Pamela Ann Japanese numeral classifiers : a syntactic, semantic, and functional profile 1984  
PL629.H65 M49 (GEST) Mizutani, Osamu, 1932- How to be polite in Japanese = Nihongo no keigo 1987   4789003388
PL635 .T6840 1983 (CJK) Toyama, Shigehiko, 1923- Nihon no shujigaku 1983 84100823 /AJ 462201193X
PL6621.U77 R41 1987 Reesink, Ger P Structures and their functions in Usan ; a Papuan language of Papua New Guinea 1987 86017518 9027230129
PL7101.D5 S33 1985 Schmidt, Annette, 1958- Young people's dyirbal : an example of language death from Australia 1985 84029228 0521305101
PL7101.W64 D64 (S) Donaldson, Tamsin Ngiyambaa : the language of the Wangaaybuwan 1980 79007646 0521225248
PL7101.W64 D64 (VPL) Donaldson, Tamsin Ngiyambaa : the language of the Wangaaybuwan 1980 79007646 0521225248
PL756.W6 J67 1997 v.19 (EAC) Tsushima, Yuko Kusa no fushido Showa 52 [1977]  
PL812.A8S71F4 1982 (ICU Harp Harp) Natsume, Soseki, 1867-1916 And then = Natsume Soseki's novel Sorekara c1977 77013175 080710387X
PL8186.1 .J33 1990g (GLX) Jakobi, Angelika Fur grammar : phonology, morphophonology and morphology c1990   3871189456
PL8233 .B3 1993 Bargery, G. P Hausa-English dictionary and English-Hausa vocabulary 1993  
PL833.I7 K55213 1998 (NNU Bobst) Mishima, Yukio, 1925-1970 Silk and insight : a novel c1998 98011263 0765602997
PL862.S76 K39 1995 (J) Tsushima, Yuko Kaze yo, sora kakeru kaze yo 1995 95456383 /AJ 4163153209
PL921 .K56 1990 Kim, Young-Joo Syntax and semantics of Korean case : the interaction between lexical and syntactic levels of representation 1990  
PL992.62\.W34 N313x\1995 Pak, Wan-so, 1931- Naked tree c1995 96150384 1885445733
PM1022 .S51 1980 Shaw, Patricia A., 1946- Theoretical issues in Dakota phonology and morphology 1980 79055856 0824045629
PM1571 .K5 1991 Kimball, Geoffrey D., 1954- Koasati grammar c1991 90012277 0803227256
PM1571.Z5 K55 1994 (F) Kimball, Geoffrey D., 1954- Koasati dictionary c1994 94016427 0803227264
PM1971 .M87 1987   Muskogean linguistics 1987  
PM202 .H36 1986 (MUSM) Haas Festival Conference on Native American Linguistics (1986 : University of California, Santa Cruz) In honor of Mary Haas : from the Haas Festival Conference on Native American Linguistics 1988 88037921 0899252818
PM2291.Z9 M5 1980a (STK) Derrick-Mescua, Mary Tyler, 1947- Phonology and morphology of Mikasuki [microform] 1980  
PM5002.E58 2000 (ICU JRL Gen)   Ensaios sobre lenguas indígenas de las tierras bajas de Sudamérica : contribuciones al 49o Congreso Internacional de Americanistas en Quito 1997 = Essays on indigenous languages of lowland South America : contributions to the 49th International Congr 2000   9057890445
PM5716 .P4 1981 (VPL) Payne, David Lawrence Phonology and morphology of Axininca Campa 1981 81052739 0883120844
PM6306 .P33 (S) Parker, Gary John Diccionario quechua, Ancash-Huailas [1976] 77464932  
PN 2596 .L6 B54 1995 (LEE) Billington, Michael, 1939- One night stands : a critic's view of British theatre 1995, c1993   0435086448
PN\2039 .N54\1998 Nightingale, Benedict, 1939- Theatre 1998   0297819577
PN\681 .B35x\1996   Bakhtin and medieval voices c1996 95052435 0813014476
PN1009.A1 L475 1994 Lesnik-Oberstein, Karin Children's literature : criticism and the fictional child 1994 93035484 0198119984
PN1083 .C64 M37 1998 (CSt GREEN STACKS) Mario, Luis Colón cantado : [descubrimiento de América como tema poético a través de los tiempos] 1999 99062942 0897299027
PN1356 .F7 1989 (BAKR)   From ode to anthem : problems of lyric poetry c1989 89040255 0299970663
PN1590 .N4\A7 Archer, Leonard Courtney, 1911- Black images in the American theatre; NAACP protest campaigns--stage, screen, radio & television [1973]   0818102969
PN1590.N4 A7 (MAIN) Archer, Leonard Courtney, 1911- Black images in the American theatre; NAACP protest campaigns--stage, screen, radio & television c1973 79175230  
PN1590\P4 P47X\2001   Performance analysis : an introductory coursebook 2001 00045789 0415224063
PN1601 .T53 v.14   Melodrama 1992   0521419581
PN173 .R44 1986 (GLX)   Rhetorics of Thomas Hobbes and Bernard Lamy c1986 85030448 0809313014
PN1912 .M46 1996 (P)   Melodrama : the cultural emergence of a genre 1996 95051255 0312126921
PN1990.6.F8 S68 1984 f (STK)   Sources de l'histoire de la radio et de la télévision en France c1984 85181068  
PN1991.3.F7 U46 1999 (PU vanp) Ulmann-Mauriat, Caroline Naissance d'un média : histoire politique de la radio en France (1921-1931) c1999 99511073 2738478964
PN1993.5.A1C56 1999 (ICU JRL Gen)   Cinéma et l'argent c1999   2091903213
PN1993.5.F7 B39 1989 Benghozi, Pierre-Jean Cinéma : entre l'art et l'argent c1989 90125623 2738401376
PN1993.5.F7 B78 1987 (S) Buache, Freddy Cinéma français des années 60 c1987 87181910 2880030641
PN1993.5.F7 M294 1998 (NNU NYU Bobst) Martin, Yves, 1936- Cinéma français, 1946-1966 : un jeune homme au fil des vagues c1998 99173091 2909310426
PN1993.5.I8 I496 1983   Indian cinema superbazaar c1983 83904296 0706922263
PN1993.5\F7 +S227\1987 Sabria, J. C Cinéma français : les années 50 : les longs métrages réalisés de 1950 à 1959 [c1987] 88200269 2717813705
PN1995.9.C56 F5513 1997 Oversize (NNU NYU Bobst) PN1995.9.C56 F5513 1997 (NNNS NSSR Parsons) Film und Mode, Mode im Film. English Fashion in film 1997 97000173 379131808X
PN1996 .G85 1997g   Guión cinematográfico 1997   9501276015
PN1997 .M643 1998 (CSt GREEN STACKS) Butterworth, Jez Mojo & a film-maker's diary 1998 gb 98048385 0571192181
PN1997.N85 R38 1987 (H) Raskin, Richard Nuit et brouillard by Alain Resnais : on the making, reception and functions of a major documentary film : including a new interview with Alain Resnais and the original shooting script 1987   8772881003
PN1997\A1 G6313\1975b Godard, Jean Luc, 1930- Woman is a woman ; [and] A married woman ; [and], Two or three things I know about her : three films 1975   0856470538
PN1998.2 .B49 1990 (BMAIN) Beylie, Claude Maîtres du cinéma français 1990 91179692 2040184961
PN1998.3 .M874\M65 1994 Moisés Aguilar, Gonzalo Lautaro Murúa c1994 94184078 9502531728
PN1998.3\.F38 F37\1993 Farina, Alberto Leonardo Favio c1993 95156537//r96 9502531558
PN1998.3\.F38 O93x\1993 Oubiña, David De cómo el cine de Leonardo Favio contó el dolor y el amor de su gente, emocionó al cariñoso público, trazó nuevos rumbos para entender la imagen y otras reflexiones c1993 94204499 9509681393
PN1998.3\.K54 A3\1993 Kieslowski, Krzysztof, 1941- Kieslowski on Kieslowski 1995, c1993 gb 94085458 0571173284
PN1998.3\.K54 I58\1999 Insdorf, Annette Double lives, second chances : the cinema of Krzysztof Kieslowski c1999 99021348 0786865628
PN1998.A3 B7 Droguet, Robert Robert Bresson .. 1966 67088996  
PN2193.E86 A88 2000 (PU vanp) Aronson, Arnold American avant-garde theatre : a history 2000 00032215 041502580X
PN2277.N5 L676 1953a (NNU Bobst) PN2277.N5 L676 1953a (NNU Bobst) Lewis, Stanley T., 1926- New York theatre : its background and architectural development, 1750-1853 1953  
PN2285 .S86 1998 (PU vanp) Sullivan, Steve Bombshells : glamour girls of a lifetime 1998 98004618 0312167903
PN2287.F55 A3 1976 (STK) Flynn, Errol, 1909-1959 My wicked, wicked ways [1960, c1959] 59007849 /L  
PN2287.F55 A3x 1976 (P) Flynn, Errol, 1909-1959 My wicked, wicked ways c1959 59007849  
PN2390 .S767 1994 Stone, Judy S. J Theatre c1994   0333600789
PN241 .M26 1985b (GLX)   Manipulation of literature : studies in literary translation c1985 85010730 //r87 0312512880
PN241 .T698 1996   Translatability of cultures : : figurations of the space between 1996 95013052 0804724849
PN2595 .W75 1998g   Writing live : an investigation of the relationship between writing and live art c1998   0953349101
PN2598.D22 L47 1997 Lesser, Wendy Director calls 1997 97020476 0520212061
PN3352.C37 D36 1995 Danow, David K. (David Keevin), 1944- Spirit of carnival : magical realism and the grotesque c1995 94042828 0813119057
PN3373 N44X\1994   New short story theories c1994 94007037 0821410873
PN4121 .Q39 1996 (PU vanp) Qubein, Nido R How to be a great communicator : in person, on paper, and on the podium c1997 96021829 //r97 0471163147
PN441 .C65 1997 ((FU) main)   Collecting fragments = Fragmente sammeln 1997 97162248//r98 352525900X
PN4748.G7 A64 1987 (BAKR) Anglo-Dutch Historical Conference (9th : 1987 : London, England) Too mighty to be free : censorship and the press in Britain and the Netherlands c1987 88196672 9060115775
PN4784.N7 J34 1989 (NNU Bobst) Jaffe, Steven Harold Unmasking the City : the rise of the urban newspaper reporter in New York City, 1800-1850 1989  
PN479 .R3 1984 Rasy, Elisabetta, 1947- Donne e la letteratura 1984   8835927218
PN495 .L57x\1990   Literature and exile 1990   9051832214
PN5117 .E54 1996 Engel, Matthew, 1951- Tickle the public : one hundred years of the popular press 1996 96166849 057506143X
PN5146.D66 A3 2000 (NjP dixn) Donegan, Lawrence No news at Throat Lake c2000 99089574 0671785400
PN5184 .F6\F73 1990   France des étrangers, France des libertés : presse et mémoire 1990   290883300X
PN5189.P3 C77 (BMAIN) Sorlin, Pierre Croix" et les Juifs (1880-1899), contribution à l'histoire de l'antisémitisme contemporain 1967 68111822  
PN5244 .L86\1996 Lumley, Robert, 1951- Italian journalism : a critical anthology 1996 95025045 0719038898
PN56.3.I6I535 1994 (ICU JRL Gen)   Indio : nacimiento y evolución de una instancia discursiva : études présentées au colloque de Montréal 1992 1994   2902879199
PN56.C63 U59 1998 (PU vanp)   (Un)writing empire 1998   9042004711
PN56.T7 K644 1989 (F) Herzog August Bibliothek. Arbeitsgruppe Kulturgeschichte des Barockzeitalters. Kolloquium (1989 : Herzog-August-Bibliothek) Reisen des Barock : Selbst- und Fremderfahrungen und ihre Darstellung : Beiträge zum Kolloquium der Arbeitsgruppe Kulturgeschichte des Barockzeitalters an der Herzog-August-Bibliothek Wolfenbüttel vom 10. bis 12. Juli 1989 1991   392488885X
PN56.T7 T57 1994 Internationales Symposion zur Reiseliteratur (1994 : Dublin, Ireland) Reisen im Diskurs : Modelle der literarischen Fremderfahrung von den Pilgerberichten bis zur Postmoderne : Tagungsakten des Internationales Symposions zur Reiseliteratur, University College Dublin vom 10.-12. März 1994 1995 96104829 3825303039
PN56.V57 M56x\1992 Minahen, Charles D Vortex/t : the poetics of turbulence c1992 91002243 0271007745
PN56\.A33 B49x\1994   Beyond the pleasure dome : writing and addiction from the Romantics c1994   1850753784
PN56\.W3 T35\1995   Tale of the next Great War, 1871-1914 : fictions of future warfare and of battles still-to-come 1995 95040302 081562672X
PN6071.G27 B59 1997 (ANXA) PN6071.G27 B59 1997   Bloom & blossom : the reader's guide to gardening c1997 96026828 0880014733
PN6115 .C6 no.63 (P)   Venexiana 1969, c1965  
PN6149.P3 P38 1997   Parody : : dimensions and perspectives 1997 97189516 904200181X
PN6381 .S4 1983 (MAIN) Serafini, Luigi Codex seraphinianus 1983 83007076 0896594289
PN6737.M6 W35 1987 Moore, Alan Watchmen 1987   0446386898
PN6790.B44 T51913 1991 Hergé, 1907- Adventures of Tintin, reporter for "Le petit vingtième" in the Congo 1991 gb 93068598 0951279947
PN6999 Falkenberg (ICU JRL Gen) Falkenberg, Marc Poetical uncanny : a study of early modern fantastic fiction 2000  
PN721 .T95\1993 Tylus, Jane, 1956- Writing and vulnerability in the late Renaissance 1993 92032209 0804721386
PN771 .E44 2001 (PU vanp) Ellison, David R Ethics and aesthetics in European modernist literature : from the sublime to the uncanny 2001 2001025769 0521806801
PN81 .E65 1996   Essays in memory of Michael Parkinson and Janine Dakyns 1996 96188118  
PN851 .W67\n.s.1\1987 Rose, Marilyn Gaddis What price glory - in translation? 1987   0918680387
PN98.P67 L56 1994 (NNU Bobst)   Liminal postmodernisms : the postmodern, the (post-)colonial, and the (post-)feminist 1994   9051837569
PQ 7798.1 .I73 C59x 1999 (LEE) Aira, César, 1949- Congreso de literatura 1999   9509779520
PQ 7798.1 .I73 S84x 1998 (LEE) Aira, César, 1949- Sueño 1998   9500418444
PQ\4617\.C6 Z79x\1997   Per Giovanni Della Casa : ricerche e contributi : Gargnano del Garda (3-5 ottobre 1996) c1997 98102594 8820507978
PQ\7798\.1\.I7 C8\1998 Aira, César, 1949- Curas milagrosas del doctor Aira : novela 1998 98173575 9879243072
PQ1319 .L5 1781a ((FTaSU) main,hum) Le Grand d'Aussy, Pierre Jean Baptiste, 1737-1800 Fabliaux ou contes du XIIe et du XIIIe siècle 1779, 1781, or 1829  
PQ1501 .P27Zr \Stack\ Roquefort, Jean Baptiste Bonaventure de, 1777-1834 Notice historique et critique du roman de Partonopex de Blois 1811  
PQ1780 .H83\1997 Hubert, Judd David, 1917- Corneille's performative metaphors 1997 96037618 1886365067
PQ1863 .B283 1998 Baschera, Marco Théâtralité dans l'oeuvre de Molière 1998   3823355201
PQ2191.P42V2 1970 (ICU JRL Gen) Baudelaire, Charles, 1821-1867 Paris spleen, 1869 1970] 7420589//r916  
PQ2191\.Z5 B358\2001   Baudelaire and the poetics of modernity 2001 00010466 0826513778
PQ2198\B38 O7\1980 Bonnetain, Paul, 1858-1899 Opium [microform] 1909  
PQ2285.L2 1921 (ICU JRL Gen) Hugo, Victor, 1802-1885 Légende des siècles 1921-25  
PQ2601.B77 F8 About, Noële Edmond, 1914- Frère jaune [1937] 38018719  
PQ2601.D323 A6 1997 (PU vanp) Cusy, Pierre Théâtre radiophonique, mode nouveau d'expression artistique [pref. 1925]  
PQ2601.L52 U5 Alem, Gilbert d' Une des sept : roman annamite c1930  
PQ2601.N4 J7 André-Cuel, George, 1889- Jonque immobile [c1926] 26021016  
PQ2603.A32 F313 1928 (VPL) Barbusse, Henri, 1874- I saw it myself [c1928] 28028888  
PQ2603.E52 F6\1924 Bellan, Charles Fleur de Lotus 1924 24030416  
PQ2603.O765 F2 Bouquet, Henry Fausse vocation : roman indochinois 1929  
PQ2605.O28 B515x 1955 Colette, 1873-1954 Aoi mugi Showa 30 [1955]  
PQ2607.E834 Z73413 (VPL) \\OTHER\COPIES\Annenbg\ (ANNBG) Kristeva, Julia, 1941- Powers of horror : an essay on abjection 1982 82004481 0231053460
PQ2607.E85H5 1916 (MAN) Nolly, Emile, b. 1880 Hiên le Maboul [1908]  
PQ2607.I65 D8 Diraison-Seylor, Olivier, 1873- Du fond des abîmes : journal de Charles Dynvic, surveillant des travaux public au Laos 1911  
PQ2607.U17 J3 Duclos-Salesses, Jeanne Janou la tonkinoise 1926 [i.e. 1928]  
PQ2609.S91 T4 Estray, Jean d' Thi-Sen, la petite amie exotique [1911] 11017843  
PQ2613.A925 M5 Gaultier, Marcel Messagère : roman 1943  
PQ2619.A112 D4313 2001 (NNU NYU Bobst) Jabès, Edmond Desire for a beginning ; Dread of one single end 2001 00008975 1887123385
PQ2623.A92 T8 Laumônier, Henri Trois années de poste : roman tonkinois [1909]  
PQ2631.E25 Z5328 (MAIN) Béguin, Albert, 1898-1957 Prière de Péguy [1948, c1942]  
PQ2631.O9 M2 Matgioï, 1861-1939 Maître des sentences 1899  
PQ2635.E36 xB7 1907 Regnier, Philibert Broussards : dans le golfe de Siam 1907  
PQ2635.E56 M6 Renaud, Jean, 1882- Mirages d'exil 1914  
PQ265 .B4413 1999 Bénichou, Paul Consecration of the writer, 1750-1830 = Le sacre de l'écrivain c1999 98042381 0803212917
PQ2663.O6 Z537 1991 (ANXA) Aira, César, 1949- Copi 1991 91818917 9509976601
PQ2670.A225 E85 2001 (PU vanp) Jaccottet, Philippe Et, néanmoins 2001   2070761924
PQ282.R34 (ICU JRL Gen) Régnier, Henri de, 1864-1936 Nos rencontres .. 1931 32000558  
PQ295.A53 M66 1996 Monneyron, Frédéric Androgyne décadent : mythe, figure, fantasmes 1996 96200252 2902709943
PQ295.M63 M6 1992 (F)   Modernity and revolution in late nineteenth-century France c1992 91050645 0874134471
PQ307.C57 B55\1988 Blanchot, Maurice Unavowable community 1988 87015996 0882680439
PQ3919.2.L163 Z464 2000 (PU vanp) Laferrière, Dany J'écris comme je vis c2000 2001325223 2845620209
PQ3979.V72 P4 Villedieu, René de Petit-fils d'Asie : fils de France 1942  
PQ3989.2.K47 P257 1988 (BAKR) Khatibi, Abdelkebir, 1938- Par-dessus l'épaule c1988   2700721497
PQ3989.2.K55 P7 (S) Khatibi, Abdelkebir, 1938- Prophète voilé : théâtre c1979 80498381 2858020884
PQ3999.C43 V35 1990 Chaze, M Vai : la rivière au ciel sans nuages 1990  
PQ4004 .G4 (NNU Bobst) PQ4004 .G4 (NNU Bobst) PQ4004 .G4 (NNU Bobst)   Da Dante al Novecento. Studi critici offerti dagli scolari a Giovanni Getto nel suo ventesimo anno di insegnamento universitario 1970 75479061 //r872  
PQ4004.G4 A77 1984 (STK)   Arte dell'interpretare : studi critici offerti a Giovanni Getto c1984 85672436  
PQ4172 .C67 1994 Cottino-Jones, Marga Dir novellando : modello e deviazioni c1994 94216422 8884021316
PQ4253.A9 F67 1992   Fosfori : 17 racconti di autori italiani contemporanei c1992   8879640046
PQ4417.M37 E5 1979 (S) Masseron, Alexandre, 1880-1959 Dante Alighieri, the poet who loved St. Francis so much [1979] 78014835 081990757X
PQ4496.E29 S33 1978 (CRO) Petrarca, Francesco, 1304-1374 Petrarch's Secret : or, The soul's conflict with passion : three dialogues between himself and S. Augustine 1978 76048450 0883555964
PQ4496.E29 S33 1989 (P) Petrarca, Francesco, 1304-1374 Petrarch's Secretum : with introduction, notes, and critical anthology c1989 88030491 0820410217
PQ4561.A1 V4 1974 (MAIN) Venexiana Veniexiana 1974  
PQ4664.T7 S6 1884a Trissino, Giovanni Giorgio, 1478-1550 Sofonisba 1884 a 53004655  
PQ4699 .C768 2000 (NjP f) Crotti, Ilaria Libro, mondo, teatro : saggi goldoniani 2000   8831773437
PQ4699.E53 1991 (ICU JRL Gen) Emery, Ted Goldoni as librettist : theatrical reform and the drammi giocosi per musica c1991 90043822 0820412309
PQ4730.R2 T4 1976 (MAIN) Radius, Anna Zuccari, 1846-1918 Teresa 1976  
PQ4817 .I22\C6 Giacosa, Giuseppe, 1847-1906 Come le foglie [1961] 61049109  
PQ4862.A69T67 1993 (ICU JRL Gen) Barbieri, Renzo Top model 1993 94139488 8845406040
PQ4862.R37 I46 1988 (NNU Bobst) Braschi, Giannina Imperio de los sue~nos 1988 88208957 8476580827
PQ4878.A73 R57 1995 (NNU Bobst) Rasy, Elisabetta, 1947- Ritratti di signora 1995   8817843865
PQ4879.C54 Z516 1996 Ania, Gillian Fortunes of the firefly : Sciascia's art of detection c1996 gb 96063335 1899293507
PQ5904\V42 F53\1988 Fido, Franco Paradiso dei buoni compagni : capitoli di storia letteraria veneta (Ruzante, Calmo, Giancarli, Parabosco; Baretti, Chiari, Casanova, Goldoni; Noventa, Marin, Giotti, Pasolini) 1988 88187354  
PQ6004 .M35 (NNU Bobst) PQ6004 .M35 (NNU Bobst)   Hommage à Ernest Martinenche; études hispaniques et américaines [1939?] ac 40001182  
PQ6085 .A38 1994 (PU vanp) Agosin, Marjorie Otro modo de ser : poesía hispánica de mujeres c1994   1881708047
PQ627.P50 (ICU JRL Gen) Pierrot, Jean Imaginaire décadent, 1880-1900 c1977 78381914 //r832  
PQ6651.G64 S66 1997g Agresti, Alejandro, 1951- Sonrisa no basta 1997   9580441987
PQ6651.M37 D56 1994g Amestoy Egiguren, Ignacio, 1947- Dionisio Ridruejo. : Una pasion española ; No pasarán! Pasionaria 1994   8424506561
PQ6651.M37 E45 1996 (PU vanp) Amestoy Egiguren, Ignacio, 1947- Elisa besa la rosa (Elixa) ; La reina austríaca de Alfonso XII 1996 96162677//r98 842450710X
PQ6651.M37 Y6 1993g Amestoy Egiguren, Ignacio Yo fui actor cuando Franco ; Mañana, aqui, a la misma hora 1993?   8424506235
PQ6657.A4 P37 1993 Gala, Antonio Pasión turca 1993   8408002511
PQ6672\.A92 P5x\1985 Vázquez Montalbán, Manuel Pianista 1985   8432205214
PQ7081 .M55 Molloy, Sylvia Diffusion de la littérature hispano-américaine en France au XXe siècle 1972 72333415  
PQ7081 .S324x\1997 Scarano, Mónica Reinvención de la memoria 1997   9508450568
PQ7081 .Z36 Zapata, Celia Ensayos hispanoamericanos c1978 78113895  
PQ7081.A1 C595 1993 (PU vanp) Conference on Latin American Literature (14th : 1993 : Montclair State University) Proyecciones sobre la novela : actas del XIV Congreso de Literatura Latinoamericana, Montclair State University 1997   0910061637
PQ7081.A1 S78 2000g   Studies in honor of Myron Lichtblau c2000   0936388935
PQ7082.N7 L34 2001 (ICU JRL Gen) Larsen, Neil Determinations : essays on theory, narrative, and nation in the Americas 2001 2001045417 185984619X
PQ7082.N7P47 1999 (ICU JRL Gen) Persino, María Silvina Hacia una poética de la mirada : Mario Vargas Llosa, Juan Marsé, Elena Garro, Juan Goytisolo c1999  
PQ7082\N7 P47\1999 Persino, María Silvina Hacia una poética de la mirada : Mario Vargas Llosa, Juan Marsé, Elena Garro, Juan Goytisolo c1999  
PQ7298.26.U35 P6 (VPL) Puga, María Luisa, 1944- Posibilidades del odio 1978   9682302595
PQ7298.26\.U33 P6 1981g Puga, María Luisa, 1944- Posibilidades del odio c1985   9682908833
PQ7298.32.I55 M38 1996 (PU vanp) Villoro, Juan, 1956- Materia dispuesta   9681903056
PQ7389.C263 T5 Carpentier, Alejo, 1904- Tientos y diferencias [1970]  
PQ7389.G75 P3 (S) Grillo Longoria, José Antonio Patos en el pantano 1976  
PQ7390.C76V47 1995 (ICU JRL Gen) Cuartas Rodríguez, Joaquín Miguel Vereda tropical : teatro cubano en tres actos : época actual 1995   847232740X
PQ7400 .V53 (S) Vicioso G., Abelardo Santo Domingo en las letras coloniales (1492-1800) 1979  
PQ7409.2.C69 A6 1982 (S) Contín Aybar, Pedro René Poemas 1982 82174879  
PQ7409.2.F47 M4 vol. 3 (S) Ferreras, Ramón Alberto Mirabal 1976 78111859  
PQ7409.T6 A7 Torres, Luis Alfredo Alta realidad 1970 77283195  
PQ7439.B9 Z571 1992g Burgos, Julia de, 1914- Desde la Escuela del Aire : Julia de Burgos, textos de radio teatro escritos por Julia de Burgos ; introducción de Roberto Ramos-Perea 1992  
PQ7439.B9 Z69 1992 (NNU Bobst) González, José Emilio Julia : o la intimidad de los instantes 1992  
PQ7439\B87\+Z9 J8X\1992   Julia de Burgos : Artes y Letras, edición facsímil del número homenaje ; nota preliminar de Edgar Martínez Masdeu 1992  
PQ7440.A69 N6 1991 (NNU Bobst) Abreu Adorno, Manuel, 1955-1984 No todas las suecas son rubias 1991 87080413 //r93 0865814066
PQ7440.U46 L66 1982 (BAKR)   Looking east c1982  
PQ7499.2.O69 R87 (F) Oreamuno, Yolanda Ruta de su evasión 1984   9977300615
PQ7551 A1\1995 Jornadas Andinas de Literatura Latino Americana (2nd : 1995 : Tucumán, Argentina) Memorias de JALLA Tucumán 1995 1997   9879646304
PQ7611 .H578 1999 (NNU NYU Bobst) PQ7611 .H578 1999 (NNU NYU Bobst)   Historia crítica de la literatura argentina 1999-   9500419955
PQ7611 .H578x\1999   Historia crítica de la literatura argentina 1999-<2000>   9500419955
PQ7654 .T59 1992 Tizón, Héctor Escritura argentina 1992 92228506 9509840343
PQ7689 .T383 1992 (BMAIN)   Teatro argentino durante el Proceso, 1976-1983 : ensayos críticos, entrevistas c1992 93202987 9508430079
PQ7797.B53 R3 1981 (GLX) Bianco, José Ratas c1981 81176488  
PQ7797.M234 Z9 (F) Velasco y Arias, María Juana Paula Manso : vida y acción   66093613  
PQ7797.M37 E8 1961 (PU stor) Mercante, Victor, 1870-1934 Estudiantes [1961] 65053759  
PQ7797.S22435 L6 1993 (F) Saer, Juan José, 1937- Lo imborrable c1993 95153173 9504000924
PQ7797.Z4 P3 1955 (P) Zeballos, Estanislao Severo, 1854-1923 Painé y la dinastía de los zorros [1955] 58015324  
PQ7798.1.I7 M385 1998 (PU vanp) Aira, César, 1949- Mendiga 1998   987972111X
PQ7798.1.I73 C66 1991 Aira, César, 1949- Copi 1991 91818917 9509976601
PQ7798.1.I73 E43x 1981 (P) Aira, César, 1949- Ema, la cautiva c1981 82156357  
PQ7798.1\.I7 L5 1991 Aira, César, 1949- Liebre c1991 93232242 9500410842
PQ7798.13.A57 H57 1999 (PU vanp) Caparrós, Martín, 1957- Historia 1999   9879334108
PQ7798.13.A57 T4 1997 (PU vanp) Caparrós, Martín, 1957- Tercer cuerpo 1997  
PQ7798.13.A755 F76 (F) Casullo, Nicolás A Frutero de los ojos radiantes c1984   9506170150
PQ7798.13\A8875 C3\2000 Casullo, Nicolás A Cátedra 2000   9879334620
PQ7798.22.A47 P64 (S) Lamborghini, Osvaldo Poemas 1980  
PQ7798.26.A88 M53 1999 (NNU NYU Bobst) Pavlovsky, Eduardo A Micropolítica de la resistencia 1999   9502309995
PQ7798.26\.E764 Z87x\1997 Rosa, Nicolás Tratados sobre Néstor Perlongher 1997   9879928024
PQ7798.26\A88 Z4\2001 Pavlovsky, Eduardo A Tica del cuerpo : nuevas conversaciones con Jorge Dubatti c2001 2001414331 9879006798
PQ7798.26\E76\Z9 L86\1996   Lúmpenes peregrinaciones : ensayos sobre Néstor Perlongher 1996   9508450398
PQ7798.26\E76\Z9 R6\1997 Rosa, Nicolás Tratados sobre Néstor Perlongher 1997   9879928024
PQ8097.M748 A6 2000 (PU vanp) Morales, José Ricardo Teatro c2000 00342857 9567991006
PQ8098.1\L54 R48\2000 Allende, Isabel Retrato en sepia c2000   8401014093
PQ8098.15 .L75\L8 1983 g Eltit, Diamela, 1949- Lumpérica 1983  
PQ8098.15.L78 L86 1998 (PU vanp) Eltit, Diamela, 1949- Lumpérica 1998   956247187X
PQ8179.I8 M313 Isaacs, Jorge, 1837-1895 ...Maria, a South American romance 1890 04016890  
PQ8401 .K75 1987 (GLX) (BAR) Kristal, Efraín, 1959- Andes viewed from the city : literary and political discourse on the Indian in Peru, 1848-1930 c1987 87017640 0820404373
PQ8497.P17 C9 1959 Palma, Clemente, 1872-1946 Cuentos malévolos 1974  
PQ8497.P2 H4x (P) Paima, Clemente, 1872- Historietas malignas 1925  
PQ8542 E73X\1996   Escritura y desafío : narradoras venezolanas del siglo XX 1996 97103707 9800109390
PQ9469.2 .R5 M318 2000 (CSt GREEN STACKS) Rivas, Manuel, 1957- Mano del emigrante c2000   8420442577
PQ9469.2.R5 M318 2001 (BAKR) Rivas, Manuel, 1957- Mano del emigrante c2001   8420442577
PQ9939 .C68 V37 1996 (CSt GREEN STACKS) Couto, Mia, 1955- Varanda do frangipani : romance c1996   9722110500
PQ9939.C68 T47 1992 (NNU NYU Bobst) Couto, Mia, 1955- Terra sonâmbula : romance c1992 93160583 9722107909
PR\888\.L46 B49x\1998   Beyond sex and romance? : the politics of contemporary lesbian fiction 1998   0704345374
PR\9199\.3\.K78 I8\1994 (URIS) PR\9199\.3\.K78 I8\1994 Kogawa, Joy Itsuka 1994 93026076 0385468857
PR1109 A27\2000\(LC)   Norton anthology of English literature c2000 99043298 0393974863
PR113 .E27 1998 (NNU Bobst)   Early women writers : 1600-1720 1998 97012383 0582304636
PR113 .P48 1999 (NNU NYU Bobst)   Pilgrimage for love : essays in early modern literature in honor of Josephine A. Roberts 1999 99039579 0866982558
PR1195.F38 D832x 1989 (MAN) Duck, Stephen, 1705-1756 Thresher's labour / two eighteenth century poems ; introduction by E.P. Thompson ; illustrations by Marian Sugden ; edited by E.P. Thompson & Marian Sugden 1989   0850363756
PR1259.H65 G39 1984   Gay plays 1984- 85151443//r86 0413523306
PR1309\G5 O945\1996   Oxford book of twentieth-century ghost stories 1996 96004913 0192142607
PR1866 .P7 Chaucer, Geoffrey, d. 1400 Tales of Canterbury, complete [1974] 72009380 0395140528
PR1984.C63 J6 1982 (P)   John Gower's literary transformations in the Confessio amantis : original articles and translations c1982 81040599 0819125962
PR226 .D55 1995 DiNapoli, Robert Index of theme and image to the homilies of the Anglo-Saxon church : comprising the homilies of Ælfric, Wulfstan, and the Blickling and Vercelli codices 1995 95223627 189828105X
PR260 .L57 (F)   Literature in fourteenth century England : the J.A.W. Bennett memorial lectures, Perugia, 1981-1982 c1983   0859911519
PR3634 .P64\1990b   Pope : new contexts 1990 gb 90026381 0745007910
PR441 .C66 2000 (PU vanp)   Companion to literature from Milton to Blake 2000 00031018 063121285X
PR4720.A5 W3 1966 (NNU NYU Bobst) PR4720.A5 W3 1966 (NNU NYU Bobst) PR4720.A5 W3 1966 (NNU NYU Bobst) Godwin, William, 1756-1836 Godwin & Mary : letters of William Godwin and Mary Wollstonecraft 1966 66027700 //r88  
PR4879.L79 S26 1983 (VPL) Lefroy, Anna Austen, 1793-1872 Jane Austen's Sanditon : a continuation 1983 83222034 0942506049
PR4989.M4 Z53x 2000 (olin)   Beyond sensation : Mary Elizabeth Braddon in context c2000 99037009 0791444198
PR5401 1985 vol. 9 Shelley, Mary Wollstonecraft, 1797-1851 Frankenstein notebooks 1996 96031647 0815316089
PR6003.O6757 H6 (VPL) Bowen, Elizabeth 1899-1973 Hotel 1928 28004075 /A59/r35I¹/2  
PR6003.O6757 L5 (P) Bowen, Elizabeth, 1899-1973 Little girls c1964 [c1963] 63020834  
PR6015.I4 G7 1894 (RBY) Hichens, Robert Smythe, 1864-1950 Green carnation 1894  
PR6045 .A37\E62\1930 Rohmer, Sax, 1883-1959 Emperor of America 1930, c1929 29028788  
PR6045.A37 F8 1995 Rohmer, Sax, 1883-1959 Fu Manchu omnibus 1995- gb 97057066 0749002719
PR6045.O72 Z5787 1996 (BAKR) Conference on Virginia Woolf (6th : 1996 : Clemson University) Virginia Woolf and the arts : selected papers from the Sixth Annual Conference on Virginia Woolf, Clemson University, Clemson, SC, June 13-16, 1996 1997 97014185 0944473334
PR6052.A46 A87 1970 ((FU) main) Ballard, J. G., 1930- Atrocity exhibition 1970 75590447 0224618385
PR6052.E5428 T474x 1997 (P) Bent, Simon Three plays 1997   1870259645
PR6052.O384 J68 1990g Bolger, Dermot, 1959- Journey home 1990 gb 90031977 0670832154
PR6053.H786 F3 2001 Churchill, Caryl Far away 2001 2001027317 1559361999
PR6053.R455 S67\2000 Cremins, Robert, 1968- Sort of homecoming 2000 99089011 0393320235
PR6053.R495 C68 2000 (NjP f) Crimp, Martin, 1956- Country 2000   057120340X
PR6054.E22 R43 1997 Deane, Seamus, 1940- Reading in the dark 1997 96049635 0394574400
PR6054.O73 K56 1982 Dorcey, Mary, 1950- Kindling c1982   0906500095
PR6054\.O68 M6x\1991 Dorcey, Mary, 1950- Moving into the space cleared by our mothers c1991   0948339764
PR6057.R389 E87 1996 (NNU NYU Bobst) Greig, David Europe ; The architect 1996   0413708802
PR6062 .U16 S5 1997 (CSt GREEN STACKS) Lucie, Doug, 1953- Shallow end 1997 gb 97024131 0413716805
PR6062.U16 P53 1998g Lucie, Doug, 1953- Plays : 1 1998   0413716902
PR6063.O8435 A4x 1999 (P) Motton, Gregory Plays three 1999, c1998   1840020210
PR6068.I292 A6 1997 (NNU Bobst) Ridley, Philip Plays 1997- 97223095 0413711005
PR6068\E35 C47\1998 Vine, Barbara, 1930- Chimney sweeper's boy c1998   0670879274
PR6069.I525W5 1987 (ICU JRL Gen) Sinclair, Iain White Chappell : scarlet tracings 1987   1870507002
PR6069.T576 S73 1995 Stock, James Star-gazy pie : two plays c1995 gb 96046316 1854592939
PR6073.I4738 R5 1989h Wilson, Robert McLiam, 1964- Ripley Bogle : a novel 1989 (1990 printing)   0233983929
PR6107.I25A112 2001 (ICU JRL Gen)   4-Play 2001   0099426439
PR678.M3 C68 1984 (MAIN)   Court masque c1984 83024820 0719009618
PR821 .L43 1985 Leeson, Robert Reading and righting : the past, present, and future of fiction for the young 1985 86156602 000184413X
PR868.T3 S35 1986 (BAKR) Sedgwick, Eve Kosofsky Coherence of Gothic conventions 1986, c1976 86005212 0416014119
PR888.S427 W67 1996 (NNU Bobst) Worthington, Kim L Self as narrative : subjectivity and community in contemporary fiction 1996 96007772 019818364X
PR9196.6 .M63 1985 (MAIN)   Modern Canadian plays 1985 85143651 0889222061
PR9199.3 .T469\O74 1989 Thompson, Judith, 1954- Other side of the dark : four plays c1989 90105658 088910378X
PR9205 J86\1996 Juneja, Renu Caribbean transactions : West Indian culture in literature 1996   0333625528
PR9364.9 .R86 2000   Running towards us : new writing from South Africa c2000 99049243 0325002312
PR9484.6 .H9 1998 (NNU NYU Bobst)   Hybridity and postcolonialism : twentieth-century Indian literature 1998   3860577301
PR9484.6 .R35x\1992   Raj nostalgia : some literary and critical implications c1992   0725805234
PR9499.3.D35 A6 1986 (BMAIN) Das, Kamala Kamala Das : a selection with essays on her work 1986 88211860 0725803002
PR9499.3.D35 A74 (VPL) Das, Kamala Alphabet of lust 1977, c1976 77905705  
PR9499.3.N3/M3 (GLX) (BUR) Narayan, R. K., 1906- Mahabharata : a shortened modern prose version of the Indian epic 1978 77021802 0670450855
PS\374\.M84 S84\1976a Stetson, Earlene Mulatto motif in Black fiction [1976]  
PS121 .K3 1972 Kartiganer, Donald M., 1937- comp Theories of American literature [1971, c1972] 73150070  
PS1449 .C85\R3\1994 Crane, Stephen, 1871-1900 Red badge of courage 1994 93009918 0393964302
PS153.H56 I59 1990 International Conference on the Hispanic Cultures of the United States (4th : 1990 : Germersheim, Germany) Gender, self, and society : proceedings of the IV International Conference on the Hispanic Cultures of the United States c1993 93026315 3631461445
PS228:I6 E56\1997   Empire : American studies : selected papers from the bi-national conference of the Swiss and Austrian Associations for American Studies at the Salzburg Seminar, November 1996 c1997   3823346857
PS3364.W4273 W5 1911 Wright, Harold Bell, 1872-1944 Winning of Barbara Worth [1911] 11022022  
PS3503.R7297 Z52 (MAIN) Brooks, Van Wyck, 1886-1963 Autobiography 1965 64019571  
PS3505 .O2453\C65\1945 Cohen, Lester, 1901-1963 Coming home : a novel 1945 45004134  
PS3513.O65 R66 ((FTaSU) main,hum) Gosselink, Sara Elizabeth, 1893- Roofs over Strawtown [1945]  
PS3513.U353.Z465 (MEYER) PS3513.U353.Z465 Guérard, Albert Joseph, 1914- Touch of time : myth, memory, and the self c1980 79092177  
PS3515.I713 R35 1985 (STK) Himes, Chester B., 1909- Rage in Harlem 1985, c1957   0850316189
PS3515.O904Z7L35 (ICU JRL Gen)   Last Celt : a bio-bibliography of Robert Ervin Howard 1976 77351659//r78  
PS3521 .E86\I7\1966 Keyes, Frances Parkinson, 1885-1970 I, The king [1966]  
PS3551 .U77 N493 1996 (CSt GREEN STACKS) Holzapfel, Anne M New York trilogy : whodunit? : tracking the structure of Paul Auster's anti-detective novels c1996 96012768 3631497989
PS3551 .U77 Z86 2001 (CSt GREEN STACKS) Springer, Carsten, 1965- Crises : the works of Paul Auster c2001 2001029850 0820453609
PS3551.N645 V56 1994 Ansay, A. Manette Vinegar Hill 1994 94017008 0670852538
PS3551.U77 Z92 2001 (NjP f) Varvogli, Aliki World that is the book : Paul Auster's fiction 2001   0853236879
PS3552.L552 S4 1980 (VPL) Bloch, Chana, 1940- Secrets of the tribe : poems c1980 80052193 0935296131
PS3552.O874 H8x 1962 (CCC) Bowles, Paul, 1910- Hundred camels in the courtyard c1962 62051513 /L  
PS3553.H2735 W3 1998 (PU vanp) Channer, Colin Waiting in vain 1998 98002968 0345411781
PS3553.H4367 G57 1999 Chevalier, Tracy Girl with a pearl earring 2000   0002258900
PS3553\O34256 H35\2000 Cohen, Nancy J Hair raiser c2000 00102604 1575666227
PS3554.E667 S44 1996 Derbyshire, John Seeing Calvin Coolidge in a dream 1996 95025613 0312140444
PS3554.U265 H68 2000 Dubus, Andre, 1959- House of sand and fog 2000 99044258 0375708413
PS3555.G292 I55 1995 Egan, Jennifer Invisible circus c1995 94006205 0385473796
PS3558 .E79785 C58 1996 Hess, Joan Closely akin to murder 1996 95046862 0525939113
PS3558.E787 T3 1991 Hershman, Marcie, 1951- Tales of the master race c1991 90056363 0060166444
PS3558\.Y55 L43\2001 Hynes, James Lecturer's tale 2001 00047836 0312203322
PS3561.O6567 B69 1989 Korder, Howard Boys' life and other plays c1989   0802131700
PS3561.O6567 S4 1992b Korder, Howard Search and destroy c1992 93112629#  
PS3562.A316 I58 1999 (P) Lahiri, Jhumpa Interpreter of maladies : stories 1999 98050895 039592720X
PS3562.A316 I58\1999 Lahiri, Jhumpa Interpreter of maladies : stories 1999 98050895 039592720X
PS3569.C5658 R47 1998 Schwartz, John Burnham Reservation Road 1998 98014580 ///r98 0375402632
PS3569.E314 M4 2000 (P) Sedaris, David Me talk pretty one day c2000 00025052 0316777722
PS3569.E618 C3 1998 (P) Senna, Danzy Caucasia 1998 97028911 //r98 1573220914
PS3569.H4773 B4X 1990 (LC) (DRA) Sherman, James Beau jest : acomely c1990   0573692084
PS3569.T3868 D53 1996 (NNNS NewSchool) Stephenson, Neal Diamond age 1996   0553573314
PS3569.T535 F38 1994 (NNU Bobst) Stinson, Susan, 1960- Fat girl dances with rocks c1994 94016522 1883523028
PS3569.T6972 B83 2001 (NjP dixn) Strohmeyer, Sarah Bubbles unbound 2001 00062232 0525945806
PS3572\.R34 G57\1999 Vreeland, Susan Girl in hyacinth blue c1999 99027405 1878448900
PS3573.A4234D53 1979 (ICU JRL Gen) Waldrop, Rosmarie Differences for four hands c1984   0935162046
PS3573.E255 P3 1999 Webster, Brenda S Paradise Farm c1999 98026875 0791440990
PS3573.I444 V5 1981 (CURJ) Willard, Nancy A visit to William Blake's inn : poems for innocent and experienced travelers c1981 80027403 /AC 0152938222
PS3573.I4785 I75 2001 (NjP f) Wimmer, Dick Irish wine trilogy 2001 00053752 0141000597
PS3573\.E255 Z465\2000 Webster, Brenda S Last good Freudian 2000 00020442 0841913951
PS374.P64 P69 1996g   Powerless fictions? : : ethics, cultural critique, and American fiction in the age of postmodernism 1996   9042000716
PS374\.S35 S63\2000   Space and beyond : the frontier theme in science fiction 2000 99033689 0313308462
PS379 .P35 1998 (BAKR)   Passion and craft : conversations with notable writers c1998 97033749 0252023870
PS42 .R4\1992   Reading their world : the young adult novel in the classroom c1992 92022108 0867093064
PS509.W62 I58 1998 (NNU Bobst)   Intimate nature : the bond between women and animals 1998 97033598 0449911225
PS591.H58 S56 1994 (PU vanp)   Shouting in a whisper : Latino poetry in Philadelphia : an anthology = Los límites del silencio : poesía latina en Filadelfia : una antología 1994   9567281041
PS648.F3 B6 1984 Boyer, Robert H., 1937- Fantasists on fantasy : a collection of critical reflections c1984 83091186 038086553X
PS648.S5 M34 1994   Major American short stories 1994 93025029 0195078993
PT 167 .D487x 1999 (LEE)   Deutschsprachige Schriftstellerinnen des Fin de siècle c1999   3534144848
PT\179 .A73x\1992 Arbeitskreis Deutsche Literatur des Mittelalters. Jahrestagung (27th : 1992 : Mölln, Austria) Schelme und Narren in den Literaturen des Mittelalters : XXVII. Jahrestagung des Arbeitskreises Deutsche Literatur des Mittelalters (Greifswald), Eulenspiegelstadt Mölln, 24.-27. September 1992 1994   3894920270
PT1439 L38\1985   Lauinger Karfreitagstragödie von 1746 1985 86210311  
PT149\A2 L58\1997   Literatur und Regionalität c1997 98171705 3631320671
PT151.W7 V48\1983   Verborgene Frau : : sechs Beiträge zu einer feministischen Literaturwissenschaft c1988   388619096X
PT151.W7M88 1993 (ICU JRL Gen)   Mütter, Töchter, Frauen : Weiblichkeitsbilder in der Literatur c1993 94187994 3476008878
PT1534.G7 K3 1991g Gregorius (Legend) Old French and German Vie du pape Saint Grégoire, ou La légende du bon pécheur = Das Leben des heiligen Papstes Gregorius, oder Die Legende vom guten Sünder c1991   3770526953
PT1534.G8 D78 1985 Duckworth, David, 1941- Gregorius : a medieval man's discovery of his true self 1985 86173092 3874526488
PT1534\G8 H35X\1995 Hallich, Oliver, 1968- Poetologisches, Theologisches : Studien zum "Gregorius" Hartmanns von Aue c1995 95236610 //r974 3631492545
PT1653 .P2\1994 Stricker, 13th cent Pfaffe Amis : Mittelhochdeutsch/Neuhochdeutsch : nach der Heidelberger Handschrift cpg 341 c 1994   3150006589
PT187 .E77 1996   Erzählungen in Erzählungen : Phänomene der Narration in Mittelalter und Früher Neuzeit c1996 97142256 3770531515
PT187 .S64 1983 (MAIN)   Spectrum Medii Aevi : essays in early German literature, in honor of George Fenwick Jones 1983 83237937 3874525783
PT2528\Z6 T436\1999   Theodor Storm, narrative strategies and patriarchy = Theodor Storm, Erzählstrategien und Patriarchat c1999 99011297 0773481699
PT2605.A25Z8H336 1992 (ICU JRL Gen) Hartung, Rudolf, 1914-1985 Elias Canetti : ein Rezipient und sein Autor : eine Dokumentation c1992 93127800 3890868851
PT2605.A58 Z65 1984g (GLX)   Elias Canettis Anthropologie und Poetik 1984   3446143149
PT2605.A58 Z878 1995 Ruppel, Ursula Tod und Canetti : Essay c1995   3434500529
PT2662.E7 I6 1989 (VPL) Bernhard, Thomas In der Höhe : Rettungsversuch, Unsinn 1989   3701705852
PT2662.E7 Z7979 2000 Schmied, Erika Thomas Bernhards Österreich : Schauplätze seiner Romane c2000   3701712050
PT2678.A65 L4835 1996 Kiel, Martin, 1967- Nexus : postmoderne Mythenbilder--Vexierbilder zwischen Spiel und Erkenntnis : mit einem Kommentar zu Christoph Ransmayrs "Die letzte Welt" c1996 97103573 3631300557
PT2678.A65 L4838 1998 (NjP f) Vollstedt, Barbara, 1969- Ovids "Metamorphoses", "Tristia" und "Epistulae ex Ponto" in Christoph Ransmayrs Roman "Die letzte Welt" 1998   3506790633
PT2685.I467 W54 1995 (NNU Bobst) Winkler, Josef, 1953- Wilde Kärnten : Menschenkind, Der Ackermann aus Kärnten, Muttersprache : drei Romane 1995   3518389777
PT313 .K47 1983   Klassiker in finsteren Zeiten, 1933-1945 : eine Ausstellung des Deutschen Literaturarchivs im Schiller-Nationalmuseum, Marbach am Neckar c1983 83217097  
PT343 .F72 1984 (GLX)   "Frauen sehen ihre Zeit" : Katalog zur Literaturausstellung des Landesfrauenbeirates Rheinland-Pfalz 1984 86225462 3129288902
PT345 .K5813 1990 (HIS) Kittler, Friedrich A Discourse networks 1800/1900 c1990 89026291 0804716161
PT36.N39 L5 2000 (NjP f)   Literatur im interkulturellen Dialog : Festschrift zum 60. Geburtstag von Hans-Christoph Graf v. Nayhauss c2000   390676544X
PT3810 .B75\1990   Bristol Austrian studies c1990 gb 92001522 0862923514
PT3951 .N65 1991 Noyes, John, 1955- Colonial space : spatiality in the discourse of German South West Africa 1884-1915 c1992 91017839 371865167X
PT401 .G388 1991 (F)   German literature at a time of change 1989-1990 : German unity and German identity in literary perspective c1991   3261044438
PT401 .G45 1993 (NNU Bobst) German Graduate Students Association. Conference (1993 : New York University) Proceedings and commentary c1994 95103125  
PT405 .G41 1992 (BMAIN)   Geist und Macht : writers and the state in the GDR 1992   9051834152
PT405 .P28 Palmier, Jean Michel, 1944- Weimar en exil : le destin de l'émigration intellectuelle allemande antinazie en Europe et aux États-Unis 1988  
PT405 .W366 1997   Wendezeiten, Zeitenwenden : Positionsbestimmungen zur deutschsprachigen Literatur, 1945-1995 c1997 98106008 3860572075
PT405 B79X\1996   Bücher haben ihre Geschichte : Kinder- und Jugendliteratur, Literatur und Nationalsozialismus, Deutschdidaktik : Norbert Hopster zum 60. Geburtstag 1996 97128348 3487102269
PT772 F58X\1998 Fitz, Angela Wir blicken in ein ersonnenes Sehen : Wirklichkeits- und Selbstkonstruktion in zeitgenössischen Romanen : Sten Nadolny, Christoph Ransmayr, Ulrich Woelk 1998 98192347 3861101696
PZ4.A669P36 (LOC) Anvil, Christopher Pandora's planet 1972 75182835//r94  
PZ5 .A495 1994   Am I blue? : coming out from the silence c1994 93029574 /AC 0060242531
PZ7.K46825 D45 1994 Kerr, M. E Deliver us from Evie c1994 94001296 /AC 0060244755
Q11 .N56 v.818 (P)   Self across psychology : self-recognition, self-awareness, and the self concept 1997 97020571 1573310344
Q11 .P6 v.74 pt.3 (BAKR) Burr, David, 1934- Eucharistic presence and conversion in late thirteenth-century Franciscan thought 1984 83073283 0871697432
Q141 .B76 1995 Brockman, John, 1941- Third culture c1995 95000083 0684803593
Q162 .H315 1993 Hall, Stephen S Mapping the next millennium 1993 92050610 0679741755
Q175 .F828 Franklin, Allan, 1938- Experiment, right or wrong 1990 89023848 0521382076
Q175 .M64 vol. 13 (SCI) Q175 .M64 v.13   Scientific explanation c1989 89020248 0816617732
Q175 .N76 1999 (NjP f) Nugayev, Rinat M Reconstruction of mature theory change : a theory-change model c1999 99036556 0820436275
Q175 .W33\1984 Watkins, John W. N Science and scepticism c1984   0091580102
Q175.5 .S736\1997 Stengers, Isabelle Power and invention : situating science c1997 97021760 0816625166
Q180.55.M4 S38 1988 Savan, Beth Science under siege : the myth of objectivity in scientific research c1988   0887943365
Q181 F8348X\2001   Free-choice science education : how we learn science outside of school c2001 00068272 0807740659
Q295 .S995 1992 (TECH) Szidarovszky, Ferenc Linear systems theory c1992 91032683 0849380138
Q295 S995X\1998\(LC) Szidarovszky, Ferenc Linear systems theory c1998 97042062 0849316871
Q325.75 .F75 2001 Hastie, Trevor Elements of statistical learning : data mining, inference, and prediction c2001 2001031433 0387952845
Q327 .D83 2000 (CSt MATH-CS STACKS) Duda, Richard O Pattern classification 2001 99029981 0471056693
Q327 .D83 2000 (CSt MATH-CS STACKS) Duda, Richard O Pattern classification 2001 99029981 0471056693
Q327 .D83 2001 (BUEN) Duda, Richard O Pattern classification 2001 99029981 0471056693
Q335 .M173 1998 (PU vanp)   Machine intelligence : perspectives on the computational model 1998 98027514 0815327684
Q335 C58X\1993\(LC) Clark, Andy Associative engines : connectionism, concepts, and representational change c1993 93018722 0262032104
Q336 .C658 1998 (PU engi)   Cognitive architectures in artificial intelligence : the evolution of research programs 1998 98027060 0815327692
q96/23823 Proceedings (British Library Document Supply Centre)   Proceedings of the risk management : expanding horizons 1993   0894481762
QA 184 .S23 2001 (LEE) Sadun, Lorenzo Adlai Applied linear algebra : the decoupling principle c2001 00039991 0130856452
QA 276 .W485 2001 (LEE) Wilcox, Rand R Fundamentals of modern statistical methods : substantially improving power and accuracy c2001 00047082 0387951571
QA 76.9 .D3 R237 2000 (LEE) Ramakrishnan, Raghu Database management systems c2000 99037109 0072322063
QA 805 .H58 1999 (LEE) Hestenes, David, 1933- New foundations for classical mechanics c1999 98031131 0792353021
QA\13 S929\1998 Stueben, Michael Twenty years before the blackboard : the lessons and humor of a mathematics teacher c1998 97074343 0883855259
QA\274\.7 .M32x\1997 MacDonald, Iain L Hidden Markov and other models for discrete-valued time series 1997 97142339 0412558505
QA\927 .K693x\1999 Knobel, Roger, 1962- Introduction to the mathematical theory of waves 1999 99039055 0821820397
QA1 .G45 1996 (MAT) Gelfand Mathematical Seminars Gelfand Mathematical Seminars, 1993-1995 c1996   0817638164
QA1 .P22 no.81 1995   Factorization estimates for Abelian varieties 1995   2130470440
QA11 .L3765 1998 (NNU NYU Bobst)   Language and communication in the mathematics classroom c1998 98024453 0873534417
QA11 .R57 2000 (ICU Eck Eck) RISHEL, THOMAS W Teaching first : a guide for new mathematicians c2000   0883851652
QA12.R475 2000 (ICU Eck Eck)   Research in collegiate mathematics education IV c2000   0821820281
QA164 .J84 2001 (PU math) Jukna, Stasys, 1953- Extremal combinatorics : with applications in computer science c2001 00055604 3540663134
QA166.17 .S64 2001 (ICU Eck Eck) Spencer, Joel H Strange logic of random graphs c2001 2001032235 3540416544
QA166.6 .G73 1993 (SM) Graver, Jack E., 1935- Combinatorial rigidity c1993 93034431 0821838016
QA184 .R48 1997 (NNU Bobst)   Resources for teaching linear algebra c1997 97070503 0883851504
QA184 .T74 1997 (MATH) Trefethen, Lloyd N. (Lloyd Nicholas) Numerical linear algebra 1997 96052458 0898713617
QA188 .B73 1999 (NNU NYU Courant) Bressoud, David M., 1950- Proofs and confirmations : the story of the alternating sign matrix conjecture 1999 99020232 0521661706
QA22 .T63x (SCI) Tod, Marcus Niebuhr, 1878- Ancient Greek numerical systems : six studies 1979   0890052905
QA22.D5623 S47\1982 Sesiano, Jacques Books IV to VII of Diophantus' Arithmetica in the Arabic translation attributed to Qusta ibn Luqa c1982 82019077 0387906908
QA224 .A647 2001 De Boor, Carl Practical guide to splines : with 32 figures 2001 2001049644 0387953663
QA241 .T63 Tod, Marcus Niebuhr, 1878- Ancient Greek numerical systems : six studies 1979   0890052905
QA248 .B376 1996 Barwise, Jon Vicious circles : on the mathematics of non-wellfounded phenomena c1996 96000809 1575860090
QA248 .B376\1996 Barwise, Jon Vicious circles : on the mathematics of non-wellfounded phenomena c1996 96000809 1575860090
QA248 V38X\1995 Vaught, Robert L., 1926- Set theory : an introduction 1995 94009544 0817636978
QA267.7 .D8x 2000 (engr) Du, Dingzhu Theory of computational complexity c2000 99053576 0471345067
QA273 .R84 2000 (ICU Eck Eck) Ross, Sheldon M Introduction to probability models c2000   0125984758
QA273.6 .E92 2000 ((FTaSU) sci) Evans, Merran Statistical distributions c2000 99088655 0471371246
QA274 .T65 1995   Topics in contemporary probability and its applications 1995 94023472 0849380731
QA274.7 .W54 1994 Rogers, L. C. G Diffusions, Markov processes, and martingales c1994- 94028241 0471950610
QA274.7 .W54\1994 Rogers, L. C. G Diffusions, Markov processes, and martingales c1994-2000 94028241 0471950610
QA274.76 W44X\2000\(LC) Wegener, Ingo Branching programs and binary decision diagrams : theory and applications c2000 00035749 0898714583
QA275.L18 1997   L1-statistical procedures and related topics c1997 97073621 0940600439
QA276 .C4675 2000 Chen, Jie, 1964- Parametric statistical change point analysis c2000 00039803 0817641696
QA276 .F683 1998 (BAKR) Freedman, David, 1938- Statistics c1998 97021345 0393970833
QA276 .H788 2000 (CSt EDUCATION STACKS) Huck, Schuyler W Reading statistics and research 2000 99044928 0321023412
QA276.12 .K586 1987 Kitchens, Larry J Exploring statistics : a modern introduction to data analysis and inference c1987 86024585 0314284982
QA276.18 .H36 1999 (CSt EDUCATION STACKS)   Handbook for teaching statistics and research methods c1999 98033522 0805830499
QA276.18 .J35\2000 Jaisingh, Lloyd R Statistics for the utterly confused c2000 00022982 0071350055
QA276.4 .L578 1996g Littell, Ramon C SAS system for mixed models c1996   1555447791
QA276.4 .M267x\1993 Marazzi, Alfio, 1947- Algorithms, routines, and S functions for robust statistics : the FORTRAN library ROBETH with an interface to S-PLUS c1993 92020326 0534196985
QA276.4 .S16 1996 (NNU Bobst) Sall, John JMP start statistics : a guide to statistical and data analysis using JMP and JMP IN software c1996 96130163 0534265650
QA276.6 .M77\2000 Mukhopadhyay, Parimal Topics in survey sampling 2001 [i.e. 2000] 00056271 0387951083
QA276.8 .E374 1993 (MATH)   Efficient and adaptive estimation for semiparametric models c1993 92033799 0801845416
QA276.8 .M65 1997 Molchanov, Ilya S., 1962- Statistics of the Boolean model for practitioners and mathematicians c1997 97128647 0471971022
QA278 .G72 (SOC) \(LC)\ Green, Paul E Analyzing multivariate data c1978 77081241 003020786X
QA278 .K46 1999g Khattree, Ravindra Applied multivariate statistics with SAS software c1999   1580253571
QA278.2 .A65 1996   Applied linear regression models c1996 95037444 025608601X
QA278.5 .H386 1994 (P) Hatcher, Larry Step-by-step approach to using the SAS system for univariate and multivariate statistics c1994 95200377 1555446345
QA278.5 +H386\1994 Hatcher, Larry Step-by-step approach to using the SAS system for factor analysis and structural equation modeling c1994 96128607 1555446434
QA278.6 .I58 1998   Interaction and nonlinear effects in structural equation modeling 1998 97049371 0805829504
QA278.6 .I58 1998 (P)   Interaction and nonlinear effects in structural equation modeling 1998 97049371 0805829504
QA279 .A5287 2000 (P) Anderson, Mark J., 1953- DOE simplified : practical tools for effective experimentation 2000 99086646 1563272253
QA279 .M67 1995 Myers, Raymond H Response surface methodology : process and product in optimization using designed experiments c1995 94045548 0471581003
QA29.G3 R38 (VPL) Reich, Karin Carl Friedrich Gauss : 1777-1977 1977 77573681 3787900993
QA29.P15 C38 1999 (NjP f) Castrucci, Sergio Luca Pacioli da'l Borgo San Sepolcro 1999  
QA297 .A83\1993 Atkinson, Kendall E Elementary numerical analysis c1993 92030897 047150999X
QA297 .R6 1998g Roache, Patrick J Verification and validation in computational science and engineering c1998 98096214 0913478083
QA297 B647X\1997\(LC) Borse, G. J. (Garold J.) Numerical methods with MATLAB : : a resource for scientists and engineers c1997 96039300 ///r97 0534938221
QA297.6 .D54 1993 Dierckx, Paul Curve and surface fitting with splines 1993   019853440X
QA3 .L28 no.1213 Lewis, L. G. (L. Gaunce), 1949- Equivariant stable homotopy theory c1986 86025968 0387168206
QA301 .S48 1999 Shakarchi, Rami Problems and solutions for Complex analysis c1999 99013255 0387988319
QA303 .H16 Hall, A. Rupert (Alfred Rupert), 1920- Philosophers at war : the quarrel between Newton and Leibniz 1980 79015724 0521227321
QA320 A85X\2001\(LC) Atkinson, Kendall E Theoretical numerical analysis : a functional analysis framework c2001 00061920 0387951423
QA326 .B74 1987 Bratteli, Ola Operator algebras and quantum statistical mechanics c1987- 86027877 0387170936
QA326 .B74 1987 (KLI) Bratteli, Ola Operator algebras and quantum statistical mechanics c1987-1997 86027877 0387170936
QA326 .D375 1996 (PU math) Davidson, Kenneth R C*-algebras by example c1996 96020184 0821805991
QA326 .F55\1996 Fillmore, Peter A., 1936- User's guide to operator algebras 1996 95038340 0471311359
QA326.B740 1987 (ICU Eck Eck) Bratteli, Ola Operator algebras and quantum statistical mechanics c1987-1997 86027877 0387170936
QA33 .V4813 1983 (F) Viète, François, 1540-1603 Analytic art : nine studies in algebra, geometry, and trigonometry from the Opus restitutae mathematicae analyseos, seu, Algebrâ novâ c1983 82021381 087338282X
QA331 .C6538 1992 (BMAIN)   Concept of function : aspects of epistemology and pedagogy [c1992] 92064064 0883850818
QA331.7 .G46\1996   Geometric complex analysis : third international research institute of Mathematical Society of Japan, Hayama, Japan 19-29 March 1995 c1996 96006822 9810224397
QA371 .W29 1991 (ENG) Walas, Stanley M Modeling with differential equations in chemical engineering 1991 90049924 0750690127
QA371.35 .C66 1998 Cooper, Jeffery Introduction to partial differential equations with MATLAB 1998 97032251 0817639675
QA371.35 .C66 1998 (NNU Courant) Cooper, Jeffery Introduction to partial differential equations with MATLAB 1998 97032251 0817639675
QA372 C39X\1992\(LC) Celia, Michael Anthony Numerical methods for differential equations : fundamental concepts for scientific and engineering applications c1992 91010537 //r93 0136269613
QA374 .A76 2000   Applications of nonstandard finite difference schemes c2000 00028292 981024133X
QA374.L340 1990 (ICU Eck Eck)   Lattice gas methods for partial differential equations : a volume of lattice gas reprints and articles, including selected papers from the Workshop on Large Nonlinear Systems, held August, 1987 in Los Alamos, New Mexico c1990 89030691 0201156792
QA377 .L53 1996 Lieberman, Gary M., 1952- Second order parabolic differential equations c1996 96035104 981022883X
QA377 .V46\1995 Veron, Laurent Singularities of solutions of second order quasilinear equations 1995 94033324 0582035392
QA377 T495X\1995\(LC) Thomas, J. W. (James William), 1941- Numerical partial differential equations c1995- 95017143 0387979999
QA402 .O94 1996 Overschee, Peter van Subspace identification for linear systems : theory, implementation, applications c1996 96161018 0792397177
QA402.5 .H387 1998 (ICU Eck Eck) HAUPT, RANDY L Practical genetic algorithms c1998 97013172 0471188735
QA402.5 .K44 1999 Kelley, C. T Iterative methods for optimization 1999 99011141 0898714338
QA471 .B78 1995   Handbook of incidence geometry : buildings and foundations 1995 94020334 044488355X
QA641 .G59 Godbillon, Claude, 1937- Géométrie différentielle et mécanique analytique .. 1969 76420748  
QA7 .M34457 2000   Mathematics : frontiers and perspectives c2000 99047980 0821820702
QA7 .M34457 2000   Mathematics : frontiers and perspectives c2000 99047980 0821820702
QA76.6 .N537 1999 (NNU NYU Courant) Nielson, Flemming, 1955- Principles of program analysis c1999 99047677 3540654100
QA76.6\.C662 1990 Cormen, Thomas H Introduction to algorithms 1990 89013027 0262031418
QA76.642 .W54 1999 (P) Wilkinson, Barry Parallel programming : techniques and applications using networked workstations and parallel computers c1999 98027241 0136717101
QA76.7 .S67 1986 (GLX) Sparck Jones, Karen, 1935- Synonymy and semantic classification c1986   0852245173
QA76.73 .C153 S24 1998 (CSt MATH-CS STACKS) Sahni, Sartaj Data structures, algorithms, and applications in C++ c1998 97031865 0071092196
QA76.73.C153 S24 1998 (ICU Eck Eck) Sahni, Sartaj Data structures, algorithms, and applications in C++ c1998 97031865 0071092196
QA76.73.F25 H336 1994 Hahn, Brian D Fortran 90 for scientists and engineers 1994   0340600349
QA76.73.P76 C57 1994 (NNU Courant) Clocksin, W. F. (William F.), 1955- Programming in Prolog 1994 94031331 0387583505
QA76.76.E95 A38 1996   Advances in knowledge discovery and data mining c1996 95045329  
QA76.76\O63 S5583X\1998\(LC) Silberschatz, Abraham Operating system concepts c1998 97028556 0201591138
QA76.8.C55 T54x 1988 (SCI) Tiley, W. Edward Using Clipper c1992 91067188 0880228857
QA76.9.A43 M36 1999 (P) Man, K. F. (Kim F.), 1951- Genetic algorithms : concepts and designs c1999 98053817 1852330724
QA76.9.D33 S25 2000 (ICU Eck Eck) Salomon, D. (David), 1938- Data compression : the complete reference c2000 00004048 0387950451
QA76.9.S63 K58 1999 (ICU Eck Eck) Klir, George J., 1932- Uncertainty-based information : elements of generalized information theory c1999 99051993 3790812420
QA76.9\A73 H87X\1993\(LC) Hwang, Kai Advanced computer architecture : parallelism, scalability, programmability c1993 92044944 0070316228
QA802 .W48 Westfall, Richard S Force in Newton's physics: the science of dynamics in the seventeenth century 1971 76139572 0444196110
QA805 .H58 1986 (CRO) Hestenes, David, 1933- New foundations for classical mechanics c1986 86000620 9027720908
QA845 .S45 1998 (ICU Eck Eck) Shabana, Ahmed A., 1951- Dynamics of multibody systems 1998 97031088 0521594464
QA9 .E56 2001 (math) Enderton, Herbert B Mathematical introduction to logic c2001 00110670 0122384520
QA9 .L624\1996   Logical reasoning with diagrams 1996 95041885 0195104277
QA9 .M347\1997   Mathematical reasoning : analogies, metaphors, and images c1997 96048234 0805819789
QA9.M4 1997 (ICU Eck Eck) Mendelson, Elliott Introduction to mathematical logic c1997   0412808307
QA90 .J33 2001 (CSt GREEN SSRC-CSLI) QA90 .J33 2001 (CSt GREEN STACKS) Jamnik, Mateja, 1973- Mathematical reasoning with diagrams : from intuition to automation c2001 2001047923 1575863235
QA931 .K478 1995 Khan, Akhtar S Continuum theory of plasticity c1995 94013851 0471310433
QA931 .K478 1995 (NNU Bobst) QA931 .K478 1995 (NNU Courant) Khan, Akhtar S Continuum theory of plasticity c1995 94013851 0471310433
QB280.5.B50 1982 (ICU JCL Sci) Bialas, Volker Erdgestalt, Kosmologie und Weltanschauung : die Geschichte der Geodäsie als Teil der Kulturgeschichte der Menschheit 1982 82237652 3879191352
QB3.S3 1968 (ICU JCL Sci) Schiaparelli, G. V. (Giovanni Virginio), 1835-1910 Opere di G.V. Schiaparelli, pubblicate per cura della Reale Specola di Brera 1969 70007449 //r85  
QB466.C64 C65 2001 (phys)   Collisional processes in the solar system c2001 2001029529 0792369467
QB475.A1 I36 1991 IAP Meeting (7th : 1991 : Paris, France) Extragalactic radio sources, from beams to jets : proceedings of the 7th IAP Meeting held at the Institut d'Astrophysique de Paris, Paris, France, 2-5 July 1991 1992 92225445 0521416027
QB479.55.M87 R34 1999   Radio galaxy Messier 87 : proceedings of a workshop held at Ringberg Castle, Tegernsee, Germany, 15-19 September, 1997 /cHermann Josef Roser, Klaus Meisenheimer (eds.) 1999 99042742 354066209X
QB582 .C48 1997 (MASTK) Chancer, Joni Moon journals : writing, art, and inquiry through focused nature study c1997 96050400 0435072218
QB721 .H292\1994   Hazards due to comets and asteroids c1994 94018759 0816515050
QB843.B55 F76 1998 (NNU Bobst) Frolov, V. P. (Valerii Pavlovich) Black hole physics : basic concepts and new developments c1998 98008195 0792351452
QC\174\.17\.D44 D48x\1999   Density matrix renormalization : a new numerical method in physics : lectures of a seminar and workshop held at the Max-Planck-Institut für Physik Komplexer Systeme, Dresden, Germany, August 24th to September 18th, 1998 c1999 99034219 3540661298
QC151 .E75 1990 (PHY) Eringen, A. Cemal Electrodynamics of continua c1990 89021880 0387969365
QC16.E5 C37 1995 Cassidy, David C., 1945- Einstein and our world 1995 94017472 0391038761
QC16.L26 B47 1987 Bensaude-Vincent, Bernadette Langevin : 1872-1946 : science et vigilance c1987   2701110815
QC173.3 .D42 1996 (NNU Bobst) Podesta, Michael de Understanding the properties of matter c1996   156032614X
QC173.4.S94 S96   Surface and interface analysis : SIA   81640545  
QC173.6 .C37 (MAT) Carmeli, Moshe, 1933- Classical fields : general relativity and gauge theory 1982 82002704 0471864374
QC173.6 .F86 1980 (KLI)   Fundamental principles of general relativity theories : local and global aspects of gravitation and cosmology c1980 80014826 0306404052
QC173.96 .I56 1989 (SM) International Symposium Foundations of Quantum Mechanics in the Light of New Technology (3rd : 1989 : Kokubunji-shi, Japan) Proceedings of the 3rd International Symposium Foundations of Quantum Mechanics in the Light of New Technology : Central Research Laboratory, Hitachi, Ltd., Kokubunji, Tokyo, Japan, August 28-31, 1989 c1990   4890270035
QC173.96 .I57 1983 (MATHP) International Symposium Foundations of Quantum Mechanics in the Light of New Technology (1983 : Kokubunji-shi, Japan) Proceedings of the International Symposium Foundations of Quantum Mechanics in the Light of New Technology : Central Research Laboratory, Hitachi, Ltd., Kokubunji, Tokyo, Japan, August 29-31, 1983 c1984 84256146 4890270019
QC173.96 .S96 1985 (PHY) Symposium on the Foundations of Modern Physics: 50 Years of the Einstein-Podolsky-Rosen Gedankenexperiment (1985 : Joensuu, Finland) Symposium on the Foundations of Modern Physics : 50 Years of the Einstein-Podolsky-Rosen Gedankenexperiment, Joensuu, Finland, 16-20 June 1985 c1985 85027141 9971500043
QC173.98 .M44 Mehra, Jagdish Historical development of quantum theory c1982- 81018452 0387906428
QC174.12 .A34 1995 Adler, Stephen L Quaternionic quantum mechanics and quantum fields 1995 94006306 019506643X
QC174.12 .G67 1997 (CSt PHYSICS STACKS) Goswami, Amit Quantum mechanics c1997 96083911 0697157970
QC174.12 .M5 1988 (PHY)   Microphysical reality and quantum formalism c1988 87037647 9027726868
QC174.17.G46 Q3 1994 ((FTaSU) sci)   Quantization and infinite-dimensional systems c1994 94044822 0306448343
QC174.17.G46 Q32 1995   Quantization, coherent states, and complex structures c1996 95051189 0306452146
QC174.17.G46 Q32 1996 (NNU Bobst)   Quantization, coherent states, and complex structures c1996 95051189 0306452146
QC174.17.I76 I573 1995 International Symposium on Mathematical Physics (1994 : Arnold Sommerfeld Institute) Nonlinear, deformed and irreversible quantum systems : proceedings of the International Symposium on Mathematical Physics : Arnold Sommerfeld Institute, 15-19 August 1994, Clausthal, Germany c1995   9810222661
QC174.17.M35B830 1995 (ICU JCL Sci) Busch, Paul, 1955- Operational quantum physics 1995 95000212 3540593586
QC174.17.P68 K4713 1982 (SM) \\Also In\SQ\ (SQ) \\Also In\SM\ Kholevo, A. S. (Aleksandr Semenovich) Probabilistic and statistical aspects of quantum theory 1982 82008235 0444863338
QC174.17.S3 A43 1999 (NNU NYU Courant) Albeverio, S. (Sergio) Singular perturbations of differential operators : solvable Schrödinger type operators 2000, c1999   052177912X
QC174.26.W28 T43 1992 (NNU NYU Bobst) QC174.26.W28 T43 1992 (NNU NYU Courant) Thaller, Bernd, 1956- Dirac equation c1992 92012288 0387548831
QC174.26\.W28 O36x\1988 Ohnuki, Y. (Yoshio) Unitary representations of the poincaré group and relativistic wave equations 1988, c1976  
QC174.35.S2 C87 1990 ((FTaSU) sci) Cushing, James T., 1937- Theory construction and selection in modern physics : the S matrix 1990 90031048 0521381819
QC174.4 .B6413 1994 Bogoliubov, N. N. (Nikolai Nikolaevich), 1909- Introduction to quantum statistical mechanics c1994 92030354 2881248799
QC174.45 .N2513\1999 Nagaosa, N. (Naoto), 1958- Quantum field theory in strongly correlated electronic systems c1999 99016714 3540659811
QC174.45 .S33 1961 Schweber, S. S. (Silvan S.) Introduction to relativistic quantum field theory [1961] 61003787 /L/r85  
QC174.52\.C66 S36\1997 Schottenloher, Martin, 1944- Mathematical introduction to conformal field theory : based on a series of lectures given at the Mathematisches Institut der Universität Hamburg c1997 97007263 //r97 3540617531
QC174.85.O6 E96 1985 (PHY) Exner, Pavel, 1946- Open quantum systems and Feynman integrals [1984], c1985 84017853 9027716781
QC174.85.O6D380 (ICU JCL Sci) Davies, E. B. (Edward Brian) Quantum theory of open systems 1976 76016963 0122061500
QC175 .N27 1971 (MATH) NATO Advanced Study Institute (1971 : Geilo, Norway) Structural phase transitions and soft modes. Proceedings of the NATO Advanced Study Institute at Geilo, Norway, 13th-20th April 1971 1971 72180347//r85 8200092569
QC175.2 .D84\1992 (ENG) QC175.2 .D84\1992 (SWAIN) QC175.2 .D84\1992 Dullien, F. A. L Porous media : fluid transport and pore structure 1992 91018975 0122236513
QC178 .C63 1991   Conceptual problems of quantum gravity : based on the proceedings of the 1988 Osgood Hill Conference, North Andover, Massachusetts, 15-19 May 1988 c1991 91009536 0817634436
QC178 .I57\1995 International School of Cosmology and Gravitation (14th : 1995 : Erice, Italy) Quantum gravity : International School of Cosmology and Gravitation XIV course, Erice, Italy, 11-19 May, 1995 : 80th birthday dedication to Peter G. Bergmann c1996 97109054 9810227868
QC178 .T47 1989   Three hundred years of gravitation 1989, c1987   0521379768
QC189.5 .W48\1979 Whorlow, R. W Rheological techniques 1980 79040992 0470267364
QC20 .L83 Ludwig, Günter, 1918- Grundstrukturen einer physikalischen Theorie 1978 79361260 0387088210
QC20.7.B6 W55 1996 (MATH) Willem, Michel Minimax theorems c1996 96019919 0817639136
QC20.7.C55 C53 1998 (ICU JCL Sci)   Clifford algebras and their application in mathematical physics : Aachen 1996 c1998 98013118 0792350375
QC20.7.G76 M63 1995   Modern group theoretical methods in physics : proceedings of the conference in honour of Guy Rideau 1995 95033175 0792336453
QC20.7.L54 G46 1995 (NNU Courant)   Geometry and quantum field theory c1995 94046731 0821804006
QC20.7.S65 B46 1988 Benn, I. M. (Ian M.) Introduction to spinors and geometry with applications in physics c1988 87021117 0852741693
QC20.7\C55 C58X\1996   Clifford (geometric) algebras with applications to physics, mathematics, and engineering c1996 96025142 0817638687
QC21 M47\28   Statistical methods for physical science 1994 93000182 0124759734
QC320.8 .I58\1983 International Thermal Conductivity Conference (18th : 1983 : Rapid City, S.D.) Thermal conductivity 18 c1985   0306419181
QC39 .B86 1996 (NNU Bobst) Busch, Paul, 1955- Quantum theory of measurement c1996 96026743 3540613552
QC39 .F75 1998 Frieden, B. Roy, 1936- Physics from Fisher information : a unification 1998 98020461 052163167X
QC39 .S48 1990 (MATH)   Complexity, entropy, and the physics of information : proceedings of the SFI Workshop entitled, "complexity, entropy, and the physics of information, held May 29 to June 10, 1989 1990 90000643 0201515091
QC425 .L55\1987 Lekner, John Theory of reflection : of electromagnetic and particle waves 1987 86024511 //r87 9024734185
QC454.R36 I57 1982 (SQ) International Conference on Raman Spectroscopy (8th : 1982 : Bordeaux, France) Raman spectroscopy, linear and nonlinear : proceedings of the Eighth International Conference on Raman Spectroscopy, Bordeaux, France, 6-11 September 1982 c1982   0471262412
QC463.P5 K86 1998 Kuptsov, A. H Handbook of fourier transform Raman and infrared spectra of polymers 1998 98021957 0444826203
QC482.S6 L33 1995 (NNU Bobst) Lachance, G. R Quantitative X-ray fluorescence analysis : theory and application c1995 94010486 0471951676
QC6.4\.R42 E8713\1989 Espagnat, Bernard d' Reality and the physicist : knowledge, duration, and the quantum world 1989 88003658 052132940X
QC6.L86\E3 Lorentz, H. A. (Hendrik Antoon), 1853-1928 Einstein theory of relativity; a concise statement [c1920]  
QC611.6.O6 G36 1998 (NNU Bobst) Gaponenko, S. V. (Sergey V.), 1958- Optical properties of semiconductor nanocrystals 1998 97035237 0521582415
QC631 .B333 1999 (P) Baylis, William E. (William Eric), 1939- Electrodynamics : a modern geometric approach c1999 98031155 0817640258
QC673 C48X\1995\(LC) Chuang, Shun Lien Physics of optoelectronic devices c1995 94024701 0471109398
QC761 .T86 1965 (PHY) QC761 .T86 1965 Turov, Evgenii Akimovich Physical properties of magnetically ordered crystals 1965 64066185  
QC793.16 .P56 1989 (PHY)   Pions to quarks : particle physics in the 1950s : based on a Fermilab symposium 1989 88025644 0521309840
QC794.6.S3 N47 1982 (P) Newton, Roger G Scattering theory of waves and particles c1982 81023326 0387109501
QC881.2.T75 I54 1997 (ICU JCL Sci)   Instrument development for atmospheric research and monitoring : lidar profiling, DOAS, and tunable diode laser spectroscopy c1997 97000368 354062516X
QC925 .C73 1996 (NNU Bobst) Crane, Robert K., 1935- Electromagnetic wave propagation through rain 1996 95020817 0471613762
QC945 H89X\1997\(LC)   Hurricanes : climate and socioeconomic impacts c1997 96029974 3540620788
QC981.8.C5 M36 2001g Markgraf, Vera Interhemispheric climate linkages 2001   0124726704
QC981.8\.C5 W395\2000   Way the wind blows : climate, history, and human action c2000 99057006 0231112084
QD131.C5 v.152 (ICU C C) Jenkins, Ron, 1932- X-ray fluorescence spectrometry c1999 98039008 0471299421
QD181.P1 S96 1982 (CONM) QD181.P1 S96 1982 Symposium on Adsorption on and Surface Chemistry of Hydroxyapatite (1982 : Kansas City, Mo.) Adsorption on and surface chemistry of hydroxyapatite c1984 83024738 030641516X
QD281.H84 C66 1992   Comprehensive handbook on hydrosilylation 1992 91031306 0080402720
QD281.O9 H63 2000 (CHEM) Hodnett, B. K Heterogeneous catalytic oxidation : fundamental and technological aspects of the selective and total oxidation of organic compounds 2000 99052447 0471489948
QD281.P6 F6 v.129 (P) Schopf, G Polythiophenes : electrically conductive polymers c1997   3540614834
QD381 .K837 1998 (P) Kumar, Anil, 23 Sept. 1946- Fundamentals of polymers c1998 97006035 0070252246
QD381.9\.S65 M32\1994   Macromolecular complexes in chemistry and biology c1994 93038677 3540571663
QD381.9\.S97 J66\1999 Jones, Richard A. L. (Richard Anthony Lewis), 1961- Polymers at surfaces and interfaces 1999 98006554 052147440X
QD382.P64 G73 1991 (BMAIN) Gray, Fiona M Solid polymer electrolytes : fundamentals and technological applications c1991 91013781 0895737728
QD382.P64 G73 1991 (ENG) Gray, Fiona M Solid polymer electrolytes : fundamentals and technological applications c1991 91013781 0895737728
QD382.P64 G74 1997 (NNU Bobst) Gray, Fiona M Polymer electrolytes c1997 gb 97048840 0854045570
QD382\.P64 G73x\1997 Gray, Fiona M Polymer electrolytes c1997 gb 97048840 0854045570
QD382\.P64 G73x\1997 Gray, Fiona M Polymer electrolytes c1997 gb 97048840 0854045570
QD412.M4 G75 2000 (PU chem)   Grignard reagents : new developments c2000   0471999083
QD431.25.A53 A45 2001   Amino acid analysis protocols 2001 00023798 0896036561
QD471 T63\1962 Tobolsky, Arthur Victor Properties and structure of polymers [1962, c1960]  
QD474 .I56 (SQ)   Intercalation chemistry 1982 81020576 0127473807
QD504 .I58\1973 International Conference on Chemical Thermodynamics (3d : 1973 : Baden, Austria) Chemical thermodynamics III : plenary lectures presented at the third International Conference on Chemical Thermodynamics held at Baden bei Wien, Austria, 3-7 September 1973 1974 77356955 040870649X
QD506 .P76   Progress in surface science   77141188  
QD511.8 .B369 1989 Barin, Ihsan Thermochemical data of pure substances c1989 89017034 089573866X
QD75.4.S8 M45 2000 (P) Meier, Peter C., 1945- Statistical methods in analytical chemistry c2000 99025291 0471293636
QD79.C45 G77 1986 ((FTaSU) sci) Grob, Kurt Making and manipulating capillary columns for gas chromatography c1986   3778513125
QD79.C45 G78 (SQ) Grob, Kurt Making and manipulating capillary columns for gas chromatography c1986   3778513125
QD903.6.H63 F47 1998 (PU vanp) Ferry, Georgina Dorothy Hodgkin : a life 1998   1862071675
QD945 .W4 1992 Weertman, Johannes Elementary dislocation theory 1992 92009613 0195069005
QD96.F56 S383 1999 Sharma, Ashutosh Introduction to fluorescence spectroscopy c1999 98035325 0471110981
QD96.X2 T6513 1990 (PHSC) Tölgyessy, Juraj Radionuclide x-ray fluorescence analysis with environmental applications 1990 90003072 0444988378
QE\43 .S46x\1995 Sen, Mrinal K Global optimization methods in geophysical inversion 1995 95012651 0444817670
QE28.3 .S735\1999 Stanley, Steven M Earth system history c1999 98021861 0716728826
QE39 .T49b (P) Ocean Drilling Program Proceedings of the Ocean Drilling Program. Scientific results 1988- 89642462  
QE508 .D331 1983 ((FU) sci) Dahlem Workshop on Patterns of Change in Earth Evolution (1983 : Berlin, West Germany) Patterns of change in earth evolution : report of the Dahlem Workshop on Patterns of Change in Earth Evolution, Berlin, 1983, May 1-6 1984   0387127496
QE605 .I75 1985 International Symposium on Fundamentals of Rock Joints, 1985, Björkliden, Sweden Fundamentals of rock joints : proceedings of the International Symposium on Fundamentals of Rock Joints, Björkliden, 15-20 September 1985 1985   918699803X
QE605 .I75 1985 International Symposium on Fundamentals of Rock Joints, 1985, Björkliden, Sweden Fundamentals of rock joints : proceedings of the International Symposium on Fundamentals of Rock Joints, Björkliden, 15-20 September 1985 1985   918699803X
QE701 .S56 no.61   Geology and paleontology of the Lee Creek Mine, North Carolina, II 1987  
QE719 .T36 Tappan, Helen Ni~na, 1917- Paleobiology of plant protists c1980 80014675 0716711095
QE720 .B74 1998 (P) Brenchley, P. J Palaeoecology : ecosystems, environments, and evolution 1998 98162877 0412434504
QE720 .P14\1990   Packrat middens : the last 40,000 years of biotic change c1990 89038454 0816511152
QE721 .S54 (SCI) Shipman, Pat, 1949- Life history of a fossil : an introduction to taphonomy and paleoecology 1981 80029053 0674530853
QE721.2.F6 P76 1991 (PHSC)   Processes of fossilization c1991 91016327 0231076746
QE752.B6 S36 1991g (GLG)   Santana fossils : an illustrated atlas c1991   0866225498
QE841 .V66\1969 \Quarto\ Voorhies, Michael R Taphonomy and population dynamics of an early Pliocene vertebrate fauna, Knox County, Nebraska 1969 72197287  
QE841 .W413 1989 Weigelt, Johannes, 1890-1948 Recent vertebrate carcasses and their paleobiological implications 1989 89004698 0226881660
QH 441.2 .M68 2001 (LEE) Mount, David W Bioinformatics : sequence and genome analysis c2001 00060252 0879695978
QH104.5 .S6 B77 1996 (CSt BIOLOGY STACKS) Briggs, Mark K. (Mark Kendig), 1961- Riparian ecosystem recovery in arid lands : strategies and references 1996 96009957 0816516421
QH128 .L35x\1992   Lake Titicaca : a synthesis of limnological knowledge c1992 92007958 0792316630
QH14 .H46 1997 (CSt GREEN STACKS) Hinchman, Hannah Trail through leaves : the journal as a path to place c1999   0393041018
QH195.A23 E38 1996 (P)   East African ecosystems and their conservation 1996 95052333 0195108175
QH344 .D35 1993 (ICU JCL Sci) Dahlem Workshop on the Role of Nonliving Organic Matter in the Earth's Carbon Cycle (1993 : Berlin, Germany) Role of nonliving organic matter in the earth's carbon cycle : report of the Dahlem Workshop on the Role of Nonliving Organic Matter in the Earth's Carbon Cycle, Berlin 1993, September 12-17 c1995 95157648 0471954632
QH351 .C66 1979 Cook, Theodore Andrea, Sir, 1867-1928 Curves of life : being an account of spiral formations and their application to growth in nature, to science, and to art : with special reference to the manuscripts of Leonardo da Vinci 1979 78014678 048623701X
QH352 .C375\2001 Caswell, Hal Matrix population models : construction, analysis, and interpretation c2001 00058836 0878930965
QH353 .W54 1996 (SZ) Williamson, Mark, 1928- Biological invasions 1996 96084897 0412311704
QH430 .I62 2000 (NNU NYU Bobst)   Introduction to genetic analysis c2000 99043254 0716735202
QH431 .B226 2001 (PU vanp) Barash, David P Revolutionary biology : the new, gene-centered view of life c2001 2001017123 0765800675
QH431 .M384 1999 (DANA)   Metabolic polymorphisms and susceptibility to cancer 1999   9283221486
QH442 G432\1993\3   Gene and chromosome analysis. Part C c1994   0120443074
QH45.5 .R495\1998 Rezendes, Paul Wild within : adventures in nature and animal teachings c1998 98011725 0874779316
QH453 .I58 1993 (SZ) International Conference on Developmental Instability, Its Origins and Evolutionary Implications (1993 : Tempe, Ariz.) Developmental instability, its origins and evolutionary implications : proceedings of the International Conference on Developmental Instabilbity, It's Origins and Evolutionary Implications, Tempe, Arizona, 14-15 June 1993 c1994 94001934 //r94 0792326784
QH453 I58X\1993 International Conference on Developmental Instability, Its Origins and Evolutionary Implications (1993 : Tempe, Ariz.) Developmental instability, its origins and evolutionary implications : proceedings of the International Conference on Developmental Instabilbity, It's Origins and Evolutionary Implications, Tempe, Arizona, 14-15 June 1993 c1994 94001934 //r94 0792326784
QH455 .G44 1986   Genetic and population studies in Wales 1986   0708308678
QH506 .M45 (CSt BIOLOGY STACKS)   Phospholipid signaling protocols c1998 98003874 0896034917
QH506 .M45 1984 vol.93   Protein phosphatase protocols c1998 98015957 0896034682
QH540 .E287 (DANA) Écoscience (Sainte-Foy, Quebec) Écoscience 1994- 95641416  
QH540.5 .U42 1997 Ulanowicz, Robert E Ecology, the ascendent perspective / : Robert E. Ulanowicz 1997 96037899 0231108281
QH541 .M574 1999 (ICU JCL Sci) Morin, Peter Jay, 1953- Community ecology c1999 98038821 0865423504
QH541.15 .L35\M67x\1995   Mosaic landscapes and ecological processes 1995   0412454602
QH541.15.S62 T87 1998 (NNU Bobst) Turchin, Peter, 1957- Quantitative analysis of movement : measuring and modeling population redistribution in animals and plants c1998 98004838 0878938478
QH541.15\E24 B75X\1999\(LC) British Ecological Society. Symposium (40th : 1999 : University of Sussex) Ecological consequences of environmental heterogeneity : the 40th symposium of the British Ecological Society, held at the University of Sussex, 23-25 March 1999 2000 00027087 0632057130
QH541.15\R45 B48X\1994\(LC)   Beyond preservation : restoring and inventing landscapes c1994 93004953 0816623473
QH541.2 .S92 1998 (P)   Successes, limitations, and frontiers in ecosystem science c1998 98004683 0387984763
QH541.2 F66X\2000\(LC) Ford, E. D. (Edward David) Scientific method for ecological research 2000 99030065 052166005X
QH541.28 .E36 1998   Ecological scale : : theory and applications c1998 97048512 0231105029
QH55 .B87 1991 Burnie, David How nature works c1991 91012432 ///r93 0895773910
QH625.A1 G7 Grove, W. B. (William Bywater), 1848-1938 British stem- and leaf-Fungi (Coelmycetes); a contribution to our knowledge of the Fungi imperfecti belonging to the Sphaeropsidales and the Melanconiales 1935-37 35016766  
QH75 .B56 1994   Biodiplomacy : genetic resources and international relations 1994   9966410775
QH75 .M65 1996   Molecular genetic approaches in conservation 1996 96024804 019509526X
QH77.A8 +N311 1991 (LC) (FOR)   Nature conservation 2 : the role of corridors c1991   0949324353
QH77.A8 N28 1991   Nature conservation. 2, The role of corridors 1991   0949324353
QH77\.I4 C66x\1998   Conserving the sacred : for biodiversity management c1998   1578080363
QH87.3 .B56 2000 (CSt BIOLOGY STACKS)   Biodiversity in wetlands : assessment, function and conservation 2000   9057820595
QK 865 H27 1998 (UALB SCIENCE) Harborne, J. B. (Jeffrey B.) Phytochemical methods : a guide to modern techniques of plant analysis 1998   0412572605
QK154 .S62 (NNU Bobst) Small, John Kunkel, 1869-1938 From Eden to Sahara: Florida's tragedy 1929 agr31000517  
QK154 .S68 Small, John Kunkel, 1869-1938 From Eden to Sahara: Florida's tragedy 1929 agr31000517  
QK308 .D52 2000 (NNU NYU Bobst) Dickson, J. H. (James Holms), 1937- Changing flora of Glasgow : urban and rural plants through the centuries c2000   0748613978
QK474 .P63x\1983 Plant Adaptation Workshop (1983 : Tromsø, Norway) Plant production in the North : proceedings from "Plant Adaptation Workshop," Tromsø, Norway, September 4-9, 1983 c1985  
QK495.L52 D26 Dahlgren, Rolf, 1932- Studies on Aspalathus and some related genera in South Africa [1963] 65000066  
QK495\O64 +L315X\2000\(LC) Lavarack, P. S. (Peter S.) Dendrobium and its relatives c2000 00039226 0881924903
QK603 .M87 1994 (DANA)   Mycota : a comprehensive treatise on fungi as experimental systems for basic and applied research 1994-<c1995 > 94019413 3540577815
QK603 M87X\1994   Mycota : a comprehensive treatise on fungi as experimental systems for basic and applied research 1994-<c1995 > 94019413 3540577815
QK625.C6C650 1992 (ICU JCL Sci)   Colletotrichum : biology, pathology and control c1992   0851987567
QK625.M4 C66 2000 (ICU JCL Sci)   Colletotrichum : host specificity, pathology, and host-pathogen interaction c2000   0890542589
QK644 .H35 1997 (CSt BIOLOGY STACKS)   Hairy roots : culture and applications c1997   905702117X
QK644 .H35x\1997 \Quarto\   Hairy roots : culture and applications c1997   905702117X
QK644 .R45\1991   Rhizosphere and plant growth : papers presented at a symposium held May 8-11, 1989, at the Beltsville Agricultural Research Center (BARC), Beltsville, Maryland c1991 90024248 0792310322
QK658 +P35\1996\(LC)   Palynology : principles and applications c1996 96083627 0931871034
QK731 N54X\1994 Niklas, Karl J Plant allometry : the scaling of form and process c1994 94002418 0226580806
QK753.C3 M18 (GNVA) QK753.C3\M18 Madsen, Erik Effect of CO2 concentration on morphological, histological, cytological and physiological processes in tomato plants 1976  
QK898.A5 A55 1995 (NNU Bobst) QK898.A5 A55 1995 (NNU Bobst)   Amino acids and their derivatives in higher plants 1995 94031641 0521454530
QK898.A5 P58 1999 (NNU NYU Bobst)   Plant amino acids : biochemistry and biotechnology c1999 98044485 0824702042
QL430.6 .D33 1996 Dame, Richard F Ecology of marine bivalves : an ecosystem approach 1996 96011641 0849380456
QL430.6 .E96 2000 (PU vanp)   Evolutionary biology of the Bivalvia 2000   1862390762
QL430.7.O9 E37 1996 (DANA)   Eastern oyster : Crassostrea virginica c1996 96076817 0943676614
QL444.M33 K83 1991 ((FTaSU) main,arch) QL444.M33 K83 1991 ((FTaSU) sci) Kuhlmann, Mark Louis, 1966- Factors influencing predation on the hermit crab Pagurus longicarpus 1991  
QL46 .P87 1986 Purcell, Rosamond Wolff Illuminations : a bestiary c1986 86008713 0393023745
QL492.5 .M65 1998 (ICU JCL Sci)   Molecular mechanisms of immune responses in insects 1998 97067950 0412712806
QL494 .B86x\1994 Büning, Jürgen Insect ovary : ultrastructure, previtellogenic growth and evolution 1994 93074897 0412360802
QL495.5 .H56 1981 (FAL) Hinton, Howard Everest, 1912- Biology of insect eggs 1981 77030390 0080215394
QL55 .C87x\1995 \Quarto\   Current issues and new frontiers in animal research : proceedings of a conference sponsored by the Scientists Center for Animal Welfare and the University of Texas Health Science Center at San Antonio in San Antonio, Texas on December 8-9, 1994 [1995] 95071537  
QL551\C6 B76\1957 Brown, F. Martin (Frederick Martin), 1903- Colorado butterflies 1957 a 58004349  
QL552 .A29 1993 Acorn, John Harrison, 1958- Butterflies of Alberta 1993 cn 93091138 1551050285
QL552 .B88\1989   Butterflies of Manitoba 1989 89191570 0920704166
QL552 .L39\1998 Layberry, Ross A Butterflies of Canada c1998 cn 97931702 0802008984
QL552 H66\1973 Hooper, Ronald R Butterflies of Saskatchewan [1973] 74150706  
QL62.5 .H37 (VET) Harthoorn, Antoine Marinus Chemical capture of animals : a guide to the chemical restraint of wild and captive animals c1976   0702005584
QL62.5 .N546\1999 Nielsen, Leon Chemical immobilization of wild and exotic animals 1999 98043258 0813829364
QL639.1 .L6 1970 Love, R. Malcolm (Robert Malcolm) Chemical biology of fishes : volume 2, advances 1968-1977 : with a supplementary key to the chemical literature 1980 72092397 0124558526
QL666\L2 +G738X\1989 Greer, Allen E Biology and evolution of Australian lizards 1989 91107691 0949324213
QL666\O6 +S42X\1991 Shine, Richard Australian snakes : a natural history c1991 91026031 0801427371
QL676.5 .D381 DeGraaf, Richard M Trees, shrubs, and vines for attracting birds : a manual for the Northeast 1979 78019698 0870232665
QL731.S6 S55 1990q (SZ) Skinner, John D Mammals of the southern African subregion 1990 91189713 0869798022
QL737.P9 E964 1996   Evolution of social behaviour patterns in primates and man : : a joint discussion meeting of the Royal Society and the British Academy c1996   0197261647
QL737.P9 R37 1972 (MUSM) Research Seminar on Prosimian biology, London University, 1972 Prosimian biology : proceedings of a meeting of the Research Seminar in Archaeology and Related Subjects : held at the Institute of Archaeology, London University 1974 74014640 0822911159
QL737.R638 B49x\1985   Biology of New World Microtus 1985 82073762 0943612071
QL737\.P9 C885\1995   Current topics in primate vocal communication c1995 95018860 030645064X
QL751.65.M3 M35 (NNU Bobst) McFarland, David Quantitative ethology 1981 81001246 0273084178
QL752.S4 1982 (ICU JCL Sci) Seber, G. A. F. (George Arthur Frederick), 1938- Estimation of animal abundance : and related parameters 1982   0852642628
QL775 .S645 1996 (DANA)   Social learning in animals : the roots of culture c1996 95052124 0122739655
QL785 .D631 1986 Domjan, Michael, 1947- Principles of learning and behavior 1986 85005276 0534052088
QM101 .S34 2000 (PU muse) Scheuer, Louise Developmental juvenile osteology c2000 99067565 0126240000
QM451 +S43 1965 (MED) Sidman, Richard L Neuroanatomy, a programmed text [1965- 65016630 //r85  
QM551 .F34 1986 (BIO) Fawcett, Don Wayne, 1917- Textbook of histology 1986 85008218 0721617298
QOA+ (Paideuma; Mitteilungen zur Kulturkunde)   Paideuma; Mitteilungen zur Kulturkunde    
QOV (Bertillon, A. Ethnographie moderne) Bertillon, Alphonse, 1853-1914 Ethnographie moderne. Les races sauvages. Les peuples de l'Afrique, les peuples de l'Amerique, les peuples de l'Océanie, quelques peuples de l'Asie .. [1882]  
QP 601 .M49 vol.327 (LEE)   Applications of chimeric genes and hybrid proteins. Part B, Cell biology and physiology c2000   0121822281
QP 88.3 .R62 2002 (LEE) Robbins, Clarence R Chemical and physical behavior of human hair c2002 00059475 038795094X
QP121 .L87\1997   Lung : scientific foundations c1997 96014140 0397516320
QP151.R9 (ICU JCL Sci) Ryle, John A. (John Alfred), 1889- Gastric function in health and disease 1926 sg 27000009  
QP251 +P525\1994   Physiology of reproduction c1994 93000853 0781700868
QP301 .B76 1997 (NNU Bobst) Bouchard, Claude Genetics of fitness and physical performance c1997 97009083 0873229517
QP360 .N4945 1986 (SW)   Neuropsychology handbook : behavioral and clinical perspectives c1986 86017764 0826146503
QP363.3 .C47 2000 (NNU NYU Bobst)   Cerebral reorganization of function after brain damage 2000 99047749 0195120264
QP363.3 .C47x 2000 (mann)   Cerebral reorganization of function after brain damage 2000   0195120264
QP363.5 .H365 2001 (PU vanp)   Handbook of developmental cognitive neuroscience 2001 00046567 026214073X
QP363.5 +H365X\2001\(LC)   Handbook of developmental cognitive neuroscience 2001 00046567 026214073X
QP382.T4A490 1992 (ICU JCL Sci)   Amygdala : neurobiological aspects of emotion, memory, and mental dysfunction 1992 91027869 0471561290
QP401 C35\1915 Cannon, Walter B. (Walter Bradford), 1871-1945 Bodily changes in pain, hunger, fear, and rage; an account of recent researches into the function of emotional excitement 1915 15009718  
QP406 .M44 2000 (MASTK)   Memory, brain, and belief 2000 99040552 0674000617
QP455 .I77 1990 (BMAIN)   Irritation c1990 89071476 0824783239
QP475 .D35 1995 Daw, Nigel W Visual development c1995 95032577 0306450232
QP517.B49 H47 1996 ((FTaSU) sci) Hermanson, Greg T Bioconjugate techniques c1996 95016511 012342335X
QP519.9.C36 C373 1998 (DANA)   Capillary electrophoresis : : theory and practice c1998 97022491 084939127X
QP519.9\B55 I58X\1994 International Symposium on Bioluminescence and Chemiluminescence (8th : 1994 : Cambridge, England) Bioluminescence and chemiluminescence : fundamentals and applied aspects : proceedings of the 8th International Symposium on Bioluminescence and Chemiluminescence, Cambridge, September 1994 c1994 96115861 0471955485
QP535.S8 H36   Handbook of stable strontium c1981 80016090 0306404176
QP572\A54 T57\1995   Tissue renin-angiotensin systems : current concepts of local regulators in reproductive and endocrine organs c1995 95019713 0306450771
QP601 .M49 v.330, etc. (PU chem) QP601 .C719 v.330, etc. (PU dent)   Hyperthermophilic enzymes c2001-   0121822311
QP624 K668\1992 (KSL) QP624 K67\1992 Kornberg, Arthur, 1918- DNA replication 1992 90026456 0716720035
QP632.M9 M93 1991 (BMAIN)   Mycotoxins and phytoalexins c1991 91000197 0849388333
QP751 .M87 1993g Murphy, Robert C Mass spectrometry of lipids c1993   0306443619
QP801.P64 B54 1992   Biodegradable polymers and plastics c1992 93119632 0851862071
QP99.3\.L5 L57\1997 \Quarto\   Lipids, health, and behavior c1997 96041709 1557983844
QR103 .E37 1996 Ehrlich, Henry Lutz, 1925- Geomicrobiology c1996 95040328 0824795415
QR502 .P746 1999 (SZ) QR502 .P746 1999   Prion biology and diseases c1999   0879695471
QR73 .I57 1994 International Symposium on the Microbial Diversity in Time and Space (1994: Tokyo, Japan) Microbial diversity in time and space c1996 96013455 0306451948
QR82.E6 E83 1996 Escherichia coli and Salmonella typhimurium Escherichia coli and Salmonella : cellular and molecular biology 1996 96000316 1555810845
QR82.E6 E83 1996 (NNU Bobst) QR82.E6 E83 1996 (NNU Bobst) Escherichia coli and Salmonella typhimurium Escherichia coli and Salmonella : cellular and molecular biology c1996 96000316 1555810845
QR82\E6 +E83\1996 Escherichia coli and Salmonella typhimurium Escherichia coli and Salmonella : cellular and molecular biology 1996 96000316 1555810845
QU136\H236\1998   Handbook of proteolytic enzymes c1998 98023079 0120793709
QY50\A5975\1999   Animal models in orthopaedic research c1999 98039579 0849321158
QZ200\I3458\1984   Impact of psychoendocrine systems in cancer and immunity 1984 83018607 0889370052
QZ200\W428c\1979 Weisman, Avery D Coping with cancer c1979 78014906 007069009X
QZ269 S994 1964c Symposium on Fundamental Cancer Research (18th : 1964 : Anderson Hospital and Tumor Institute) Cellular radiation biology; a symposium considering radiation effects in the cell and possible implications for cancer therapy, a collection of papers 1965 65015703  
R 726.7 .H36 1995 (LEE)   Handbook of health and rehabilitation psychology c1995 95040862 0306449706
R154.P374 A35 (SCI) Peller, Sigismund, 1890- Not in my time : the story of a doctor c1979 79083607 0802222390
R-23747 (CRLL)   Evraziia--istoricheskie vzgliady russkikh emigrantov 1992 93192815 5201004148
R506 .P3 C66 1998 (CSt GREEN STACKS)   Constructing Paris medicine 1998   9042006919
R506.P3 C66 1998 (ICU JRL Gen)   Constructing Paris medicine 1998   9042006919
R726.5 .U53 2000 (NNU NYU Bobst)   Understanding and changing health behaviour : from health beliefs to self-regulation c2000   9058230740
R726.7 .B457 2000 (ICU JCL Sci) Bennett, Paul, 1955- Introduction to clinical health psychology 2000 00037365 0335204988
R726.7 .H36 1995 (NNU Bobst) R726.7 .H36 1995 (NNU Bobst)   Handbook of health and rehabilitation psychology 1995 95040862 0306449706
R726.7 .I54 1991 (P)   International development of health psychology c1991 91007019 371865119X
R726.7 .S75 1994   Psychosocial processes and health : a reader 1994 93049004 0521416108
R726.7 .S75 1994 (NNU Bobst) Steptoe, Andrew Psychosocial processes and health : a reader 1994 93049004 0521416108
R853.H8 S36 2000 (NNU NYU Bobst)   Science of self-report : implications for research and practice 2000 98033155 0805829903
R853.S7 H68 2000 Hougaard, Philip Analysis of multivariate survival data 2000 00040047 0387988734
R853.S7 T47 2000 (NjP spia) Therneau, Terry M Modeling survival data : extending the Cox model 2000 00030758 0387987843
RA 440.85 .D47 1998 (LEE) DePoy, Elizabeth Introduction to research : understanding and applying multiple strategies c1998 98023839 0815109792
RA1138.I65 1999 (ICU JCL Sci) International Society for Forensic Haemogenetics. Congress Progress in forensic genetics 8 : proceedings of the 18th International ISFH Congress, San Francisco, CA, USA, 17-21 August 1999 c2000   044450303X
RA1147.5 .F665 1999 (PU vanp)   Forensic neuropsychology : fundamentals and practice c1999 99022363 9026515448
RA1151 .F656 1986 (SW)   Forensic psychiatry and psychology : perspectives and standards for interdisciplinary practice c1986 85025398 0803622953
RA1242\.P56 O74\1992   Organophosphates : chemistry, fate, and effects 1992 91025947 0121673456
RA1270\S6 B76\(LC) (KSL) RA1270\S6 B76\1965 Browning, Ethel Toxicity and metabolism of industrial solvents 1965 65013228  
RA399\.A1 A875\2000 Applebaum, Robert Assessing satisfaction in health and long-term care : practical approaches to hearing the voices of consumers c2000 99042882 0826113052
RA407 .S66 1999 (DANRF)   SPM handbook of health assessment tools 1999  
RA410 .F69 (F) Fox, Daniel M Economists and health care : from reform to relativism 1979 79022036 0882021281
RA410.5 .C688 1996 (HSLB)   Cost-effectiveness in health and medicine 1996 96004753 0195108248
RA418 .L66 1997 Lorber, Judith Gender and the social construction of illness c1997 97004588 0803958137
RA418 .W45 1996 (P) Wilkinson, Richard G Unhealthy societies : the afflictions of inequality 1996 96021560 0415092345
RA418.3.D48 T48 1983 (NEWM) RA418.3.D48 T48 1983   Third world medicine and social change : a reader in social science and medicine c1983 83012542 0819134198
RA427 +L54\1999   Lifestyle medicine c1999 99013000 086542294X
RA446.5.M49 U8 1998 (SPR) RA446.5.M49 U8 1998   U.S.-Mexico border health : issues for regional and migrant populations c1998 98008903 0761908951
RA448.5.C45 S53 2001 (PU vanp) Shah, Nayan, 1966- Contagious divides : epidemics and race in San Francisco's Chinatown c2001 2001027615 0520226283
RA448.5\C45 S53X\2001\(LC) Shah, Nayan, 1966- Contagious divides : epidemics and race in San Francisco's Chinatown c2001 2001027615 0520226283
RA468\.C37 S65x\1998 Solano Alonso, Jairo, 1949- Salud, cultura y sociedad : Cartagena de Indias, siglos XVI y XVII [1998]   9589180825
RA499 M87\1996\(LC) Murard, Lion Hygiène dans la République : la santé publique en France, ou, l'utopie contrariée : 1870-1918 c1996 97128679 221359788X
RA567.B560 1983 (ICU JCL Sci)   Biological health risks of sludge disposal to land in cold climates 1983 84145361 0919813003
RA643 .C664 2001 (NjP f)   Contagion : historical and cultural studies 2001 00065338 0415246717
RA643.7.F8 A37 1999 Aisenberg, Andrew Robert Contagion : disease, government, and the "social question" in nineteenth-century France c1999 98036505 0804733953
RA644.A25C750 1990 (ICU JCL Sci) Crimp, Douglas AIDS demo graphics 1990 89081756 094192016X
RA776.9 H36 1998 (NNU Bobst)   Handbook of health behavior change c1998 98025632 0826167810
RA997 .B46 Bennett, Clifford, 1923- Nursing home life : what it is and what it could be c1980 80052650 0913292192
RA997 L565\2001   Linking quality of long term care and quality of life 2001 00045024 0826113818
RB127 .H358 1999   Handbook of pain syndromes : biopsychosocial perspectives 1999 98036687 //r98 0805826807
RB152 M84\1995 (KSL)   Multiple chemical sensitivity : a scientific overview c1995 94074818 0911131531
RC 1210 .A22x 2000 (LEE)   ABC of sports medicine 2000   0727913662
RC 267 .A77 1999 (LEE)   Unequal burden of cancer : an assessment of NIH research and programs for ethnic minorities and the medically underserved 1999 99006105 0309071542
RC 386.6 .N48 P73 2000 (LEE)   Practitioner's guide to evaluating change with neuropsychological assessment instruments c2000 99057688 030646361X
RC 451.4 .T67 M46x 2001 (LEE)   Mental health consequences of torture c2001 00059276 0306464225
RC 454 .C636 2001 (LEE)   Comprehensive handbook of psychopathology c2001 00046622 030646490X
RC137 .D457\1997   Dengue and dengue hemorrhagic fever c1997 97013184 0851991343
RC262.C78 (ICU JCL Sci) Cope, John Cancer: civilization: degeneration. The nature, causes and prevention of cancer, especially in its relation to civilization and degeneration, with fifty-five illustrations 1932 sg 32000015  
RC271\C55 C58\1999   Cisplatin : chemistry and biochemistry of a leading anticancer drug c1999   3906390209
RC327 E97 1990 (PU vanp) European Congress on the History of Psychiatry and Mental Health Care (1st : 1990 : 's Hertogenbosch, Netherlands) Proceedings of the 1st European Congress on the History of Psychiatry and Mental Health Care : 's-Hertogenbosch, the Netherlands, 24-26 October 1990 1993   9052350361
RC347.5 V85\1992   Vulnerable brain and environmental risks c1992 92049396 0306441489
RC348 N45\2000 Nell, V Cross-cultural neuropsychological assessment : theory and practice c2000 99032682 0805833552
RC372.A2 E65\1994   Epilepsy and quality of life c1994 94004424 0781701759
RC386.2 .R45x\1986 \Quarto\ Reitan, Ralph M Traumatic brain injury 1986-1988   0934515069
RC386.6.H34 R45 1993 (P) Reitan, Ralph M Halstead-Reitan neuropsychological test battery : theory and clinical interpretation c1993 91068055  
RC386.6.N48 G65 2000 (ICU JCL Sci) Golden, Charles J Neuropsychological interpretation of objective psychological tests c2000   0306462249
RC386.6.N48 N474 2000 (MASTK)   Neuropsychological assessment in clinical practice : a guide to test interpretation and integration c2000 99019227 0471193259
RC386.6.N48 N474 2000 (NNU NYU Bobst)   Neuropsychological assessment in clinical practice : a guide to test interpretation and integration c2000 99019227 0471193259
RC386.6.N48 P73 2000 (MASTK)   Practitioner's guide to evaluating change with neuropsychological assessment instruments c2000 99057688 030646361X
RC386.6\N48 C53\1992   Clinical syndromes in adult neuropsychology : the practitioner's handbook 1992 92000840 0444812717
RC386.6\N48 H35\2000\(LC)   Handbook of cross-cultural neuropsychology c2000 00035713 0306463237
RC386.6\N48 N49\1997   Neuropsychology handbook c1997 97023192 0826197302
RC387.5 .E93 1999 (NNU Bobst)   Evaluation and treatment of mild traumatic brain injury 1999 98033439 080582393X
RC387.5 .I478 2000 (ICU JCL Sci)   International handbook of neuropsychological rehabilitation c2000 99041442 0306461749
RC387.5 .P754\1999 Prigatano, George P Principles of neuropsychological rehabilitation 1999 98050681 0195081439
RC387.5 .R53 2000 (NNU NYU Bobst) Richardson, John T. E Clinical and neuropsychological aspects of closed head injury 2000 00702604 0863777511
RC388 .S45 1989 (F) Sienkiewicz-Mercer, Ruth I raise my eyes to say yes 1989 89033919 039546109X
RC394.C64 M53 1986 (BMAIN) Mid-South Conference of Human Neuropsychology on the Rehabilitation of Cognitive Disabilities (4th : 1986 : Memphis, Tenn.) Rehabilitation of cognitive disabilities c1987 87007948 0306425947
RC394.K6 V49 1989 (MED) Victor, Maurice, 1920- Wernicke-Korsakoff syndrome, and related neurologic disorders due to alcoholism and malnutrition 1989 88030965 0803689217
RC439 .G2813 1999 (PU vanp) Gauchet, Marcel Madness and democracy : the modern psychiatric universe c1999 98045014 0691033722
RC451.4.A5 H358 1999 (PU vanp)   Handbook of assessment in clinical gerontology 1999 98051809 0471283002
RC451.4.A5 H39 1997   Handbook of neuropsychology and aging c1997 97012001 0306454602
RC451.4.M47 N49 1992 (BMAIN) Nezu, Christine M Psychopathology in persons with mental retardation : clinical guidelines for assessment and treatment c1992 90064044 0878223290
RC451.4.W6 M66 2000   Mood disorders in women c2000   1853175455
RC451.N5 S23 1999 (NNU NYU Bobst) Sadowsky, Jonathan Hal Imperial bedlam : institutions of madness in colonial southwest Nigeria c1999 99010222 0520216172
RC454.4 .D483 1995   Developmental psychopathology c1995 94036391 0471532576
RC454.4 .D483\1995   Developmental psychopathology c1995 94036391 0471532576
RC454.4 .T46 2001 (NjP sw) Thayer, Robert E Calm energy : how people regulate mood with food and exercise 2001 00054849 0195131894
RC454.4 P726\1999   Primary care psychiatry and behavioral medicine : brief office treatment and management pathways c1999 98042017 0826112242
RC455 .S622 1991 (NNU NYU Bobst) RC455 .S622 1991 (NNU NYU Bobst)   Social psychiatry : theory, methodology, and practice c1991 90011304 088738403X
RC455.4 .S87\E83\1997   Evaluating stress : a book of resources 1997 96042961 0810832313
RC455.4.B5 C76 1998 (MASTK) Crowe, Simon F Neuropsychological effects of the psychiatric disorders c1998   9057022893
RC455.4.E46 N487x 2000 (P)   Neuropsychology of emotion 2000 99045300 0195114647
RC455.4.S45 G475 1995   Gender and psychopathology c1995 95004161 //r95 0880485647
RC456 .H35 1993   Handbook of effective psychotherapy c1993 93023996 0306444283
RC46.M9 (ICU JCL Sci) Musser, John Herr, 1856-1912. ed Handbook of practical treatment 1911-17 11001495  
RC469 H374\2000   Handbook of psychological assessment in primary care settings 2000 99048451 0805829997
RC473.N48 N47 1996 (NNU Bobst)   Neuropsychological assessment of neuropsychiatric disorders 1996 95049329 019509073X
RC473\P79 U83\1999   Use of psychological testing for treatment planning and outcomes assessment c1999 98034838 0805827617
RC473\P79 U83\1999   Use of psychological testing for treatment planning and outcomes assessment c1999 98034838 0805827617
RC480 S92\1996   Synopsis of treatments of psychiatric disorders, second edition c1996 96043619 088048859X
RC480.5 .H24 (NEWM) RC480 .H27 1969 Haley, Jay Power tactics of Jesus Christ, and other essays [1969] 74088568 //r89 0670570362
RC480.5 .T5187 1996 (P)   Therapist as a person : life crises, life choices, life experiences, and their effects on treatment 1996 96027077 0881631787
RC480.7 .S54 1988 Shea, Shawn C Psychiatric interviewing : the art of understanding 1988 88003155 0721617484
RC480.8 .N38 1995 (PU vanp) Natterson, Joseph M., 1923- Primer of clinical intersubjectivity c1995 94043799 1568214464
RC480.8 .R43 1999 (PU vanp) Mitchell, Stephen A., 1946- Relational psychoanalysis : the emergence of a tradition 1999   0881632708
RC480.8 .Y47 1998 (PU vanp) Yerushalmi, Herzel Psychobiographic approach to psychotherapy : a study of the power structure of psychotherapy c1998 97021398 1887841121
RC488 .G726 1997 (P)   Group therapy for medically ill patients c1997 96027736 1572301686
RC489 .A7\R63\1994 Robbins, Arthur, 1928- Multi-modal approach to creative art therapy c1994 94236986 1853022624
RC489.A7 A784   Art therapy viewpoints 1980 79026087  
RC489.B4 B47 1997   Best of Behaviour research and therapy 1997 97037215 0080430783
RC489.B4 K65 1991 (P) Kohlenberg, Robert J Functional analytic psychotherapy : creating intense and curative therapeutic relationships 1991 91021357 0306438577
RC489.C63 G74 1995 ((FTaSU) sci) Greenberger, Dennis Mind over mood : a cognitive therapy : manual for clients c1995 95008223 0898621283
RC489.I55 I58 1998 (ICU JCL Sci)   Interpersonal psychotherapy c1998 98010859 0880488360
RC489.M53 R67\1985 Rosenberg, Jack Lee, 1932- Body, self, and soul : sustaining integration c1985 85002293 0893340820
RC489.S74 P37 1994 Parry, Alan. (Thomas Alan) Story re-visions : narrative therapy in the postmodern world 1994 94018296 0898622131
RC506 .C25 1984 (NNU Bobst) RC506 .C25 1984 (NNNS NewSchool) Caligor, Judith Individual and group therapy : combining psychoanalytic treatments c1984 83046117 0465032508
RC506 .S738 1992 Stolorow, Robert D Contexts of being : the intersubjective foundations of psychological life 1992 92021982 0881631523
RC514 .G693 1998 Green, Michael Foster Schizophrenia from a neurocognitive perspective : probing the impenetrable darkness c1998 97026855 0205184774
RC514 C875\2001   Current issues in the psychopharmacology of schizophrenia c2001 2001029301 0781724228
RC514 N35\2000   Negative symptom and cognitive deficit treatment response in schizophrenia c2001 00023099 0880487852
RC521 D458\1996   Dementias : diagnosis, management, and research c1996 95019191 0880487186
RC523 .N485 1993   Neuropsychology of Alzheimer's disease and other dementias 1993 92049274 019506612X
RC532 .W58 1991   Witchcraft and hysteria in Elizabethan London : Edward Jorden and the Mary Glover case 1991 90008435 0415017882
RC533 .O267 2000 ((FTaSU) sci)   Obsessive-compulsive disorder : contemporary issues in treatment 2000 98056188 0805828370
RC533.A88 W55 1999 (NNU NYU Bobst) Willey, Liane Holliday Pretending to be normal : living with Asperger's Syndrome 1999   1853027499
RC533.A88 W55 1999 (NNU NYU Bobst) Willey, Liane Holliday Pretending to be normal : living with Asperger's Syndrome 1999   1853027499
RC533.A88 W55x 1999 (P) Willey, Liane Holliday Pretending to be normal : living with Asperger's Syndrome 1999   1853027499
RC537 .D444 1990 (BMAIN)   Depression : new directions in theory, research and practice c1990 cn 89095202 0921332289
RC537 .I576 1996 (NNNS NSSR NewSchool)   Interpersonal factors in the origin and course of affective disorders c1996 96214252 0902241907
RC537 .S59 1986 (SOCWK)   Social support, life events, and depression 1986 85011062 0124506607
RC550 953G Ginzberg, Eli, 1911- Psychiatry and military manpower policy, a reappraisal of the experience in World War II 1953 53012344  
RC552.P67 D531 1986   Disaster stress studies : new methods and findings c1986 86010913 0880481331
RC552.P67 H66 1999 (ICU SSAd SSAd)   Honoring differences : cultural issues in the treatment of trauma and loss c1999 99011369 0876309341
RC552.P67 R57 1999 (ICU JCL Sci)   Risk factors for posttraumatic stress disorder c1999 98043412 0880488166
RC552.S62 E95\1999   Extreme fear, shyness, and social phobia : origins, biological mechanisms, and clinical outcomes 1999 98051459 0195118871
RC552\.E18 E2853\2001   Eating disorders : new directions in treatment and recovery c2001 00055497 023111852X
RC552\P67 P7715\2000   Psychological debriefing : theory, practice, and evidence 2000 99052565 0521647002
RC553.A88 L39 2000 (NNU NYU Bobst) Lawson, Wendy, 1952- Life behind glass : a personal account of autism spectrum disorder 2000 00040567 1853029114
RC560.S47 S68 1998 (PU vanp)   Sourcebook of treatment programs for sexual offenders c1998 98021057 030645730X
RC569 .R48 (P)   Review of suicidology : an official publication of the American Association of Suicidology c1997- 97642077  
RC569.5 .I46\I49\1997   Impulsivity : theory, assessment, and treatment c1997 97020961 1572302259
RC570 .R44 (BMAIN) RC570 .R44 Reitan, Ralph Meldahl, 1922- Clinical neuropsychology: current status and applications 1974 73022173 0470716231
RC570 .R44 (BMAIN) RC570 .R44 Reitan, Ralph Meldahl, 1922- Clinical neuropsychology: current status and applications 1974 73022173 0470716231
RC591 S44\1998   Self-management of asthma c1998 97049681 0824798589
RC607.A26 J657 1994 (PARM) Jones, Carolyn Living proof : courage in the face of AIDS 1994 93044062 1558597131
RC607.A26 P67 1993 (NNU Bobst)   Positive lives-- responses to HIV : a photodocumentary 1993 93040472 0304328464
RC660 .H364\1994   Handbook of psychology and diabetes : a guide to psychological measurement in diabetes research and practice c1994 94004391 3718655624
RC662 .W46\1987 Whitaker, Julian M Reversing diabetes c1987 86040416 0446513040
RC685.C6 T95 1991 (SW)   Type A behavior c1991 90024163 0803940890
RC776.H9 B44 1994 (SW)   Behavioral and psychological approaches to breathing disorders c1994 93044087 0306444461
RC840.I903 (ICU JCL Sci) Ivy, A. C. (Andrew Conway), 1893- Peptic ulcer 1950 50004047  
RC969.H43 G85 1992 (MAIN)   Guidelines for employee health promotion programs c1992 91028162 0873223519
RD28\A1 T43\2000   Teaching and learning in medical and surgical education : lessons learned for the 21st century 2000 99052564 0805835423
RD594 .R44 1990 (MED)   Rehabilitation of the adult and child with traumatic brain injury 1990 89007929 0803676263
RD598 .I537 1989 ((FTaSU) sci) International Symposium on the Impact of Cardiac Surgery on the Quality of Life: Neurological and Psychological Aspects (3rd : 1989 : New York, N.Y.) Impact of cardiac surgery on the quality of life : neurological and psychological aspects c1990 90014215 0306436892
RD598 .Q35 1992 (HSLB)   Quality of life after open heart surgery c1992 91046511 0792315804
RD598.C3990 1993 (ICU JCL Sci)   Cerebral damage before and after cardiac surgery c1993 92049816 0792319281
Regenstein Stacks BR9999 Dodson Dodson, Linden Seymour, 1896- The organizing and conserving force of the church in social change in South Holland, Illinois,    
RHEES QH.L12v.21 Jackson, H. Gordon Eupagurus 1913  
RJ1 .J17   Journal of developmental and behavioral pediatrics : JDBP [1980- 80644911//r85  
RJ102 .E54 1997   Enhancing children's wellness c1997 97004750 0761910913
RJ456.E48 S33 1979 (MED) Schaefer, Charles E Childhood encopresis and enuresis : causes and therapy c1979 79009995 0442245041
RJ47.5 .C4415 1996 (NNU Bobst)   Child development and behavioral pediatrics 1996 96015892 0805823646
RJ486 .C43 1999   Changing nervous system : neurobehavioral consequences of early brain disorders 1999 98045750 0195121937
RJ486 C43\1999   Changing nervous system : neurobehavioral consequences of early brain disorders 1999 98045750 0195121937
RJ496.P3 L76 no.48-49 (MED)   Bladder control and enuresis 1973 74189888  
RJ499 .D478\1999   Developmental approaches to prevention and intervention 1999 98033332 1580460356
RJ499 .D4823 1999   Developmental issues in the clinical treatment of children c1999 98020824 0205170013
RJ499.3 .H332 2000 (ICU JCL Sci)   Handbook of developmental psychopathology c2000 00028722 0306462753
RJ499.3 H332\2000   Handbook of developmental psychopathology c2000 00028722 0306462753
RJ502.4 .L56 1998 Lindblad-Goldberg, Marion Creating competence from chaos : a comprehensive guide to home-based services c1998 98020695 0393702642
RJ503.6 .C46 2000 (MASTK) Cepeda, Claudio, 1942- Concise guide to the psychiatric interview of children and adolescents c2000 99026053 088048330X
RJ506.A58 A585 2001 (ICU JCL Sci)   Anxiety disorders in children and adolescents : research, assessment, and intervention 2001 00033696 0521789664
RJ506.A9A964 2001 (ICU JCL Sci)   Autistic spectrum disorders : educational and clinical interventions 2001   0762308184
RJ506.B44 T73 1998   Treatment of childhood disorders c1998 98024806 1572302763
RJ506.C65 K389 1995 Kazdin, Alan E Conduct disorders in childhood and adolescence c1995 95005295 0803971818
RJ506.D47 P795 2001 (NNU NYU Bobst)   Psychological and developmental assessment : children with disabilities and chronic conditions c2001 00052781 1572306459
RJ506.O66 B87 2000 (NNU NYU Bobst) Bustamante, Eduardo M Treating the disruptive adolescent : finding the real child behind oppositional defiant disorders c2000 99037817 0765702355
RJ506\B44 H25\1999   Handbook of disruptive behavior disorders 1999 98056517 0306459744
RJ507\S77 H36\1997   Handbook of children's coping : linking theory and intervention c1997 97016901 0306455366
RJ85 .C45x\1994   Children as research subjects : science, ethics, and law 1994 93003589 0195071034
RK66 952P Page, Melvin E Degeneration, regeneration [c1949] 50004475  
RL131 .P559 2000 (ICU JCL Sci) Plewig, Gerd, 1939- Acne and rosacea c2000   3540667512
RL765 .L23\1997   Laboratory handbook of dermatophytes : a clinical guide and laboratory handbook of dermatophytes and other filamentous fungi from skin, hair, and nails c1997 97023344 0898631572
RM222.2 .R68 (LC) (S) Roth, Geneen Breaking free from compulsive eating c1984 84002866 0026052806
RM301.41 .T486 1996 (NNU Bobst)   Textbook of receptor pharmacology c1996 96014485 0849392276
RM332 .F45 1996 (DANA) Feighner, John Preston, 1937- Selective serotonin re-uptake inhibitors : advances in basic research and clinical practice c1996 95039512 //r96 0471956007
RM666.A564 A67 1998 (ICU JCL Sci)   Applied antisense oligonucleotide technology c1998 97017640 0471172790
RM666.E55 H68 1985 (BMAIN) Howell, Edward, 1898- Enzyme nutrition : the food enzyme concept c1985 85011222 0895293005
RS 164 .P534 2000 (LEE)   Phytochemicals and phytopharmaceuticals c2000 99056987 1893997057
RS164.B6260 1980 (ICU JCL Sci) Boltarovych, Zoriana IEvheniïvna Narodne likuvannia ukraïntsiv Karpat kintsia XIX--pochatku XX st. 1980 82464825  
RS201.P65 P644 1994   Polymeric site-specific pharmacotherapy c1994 93039724 0471938246
RZ999 .S368 1998 Schulz, Mona Lisa Awakening intuition : using your mind-body network for insight and healing c1998 97046149 0517707586
S494.5.S86 F67 1997   For all generations : making world agriculture more sustainable c1997 96071652 0965576701
S535.A3 A6 1947 Amadeo, Tomás, 1880-1950 Redención por la mujer 1947  
S540\.M34 M334\1996 MacKenzie, David R Principles of agricultural research management 1996 95045495 0761801979
S590 .A24   Advances in soil science 1985- sn 84007060  
S592.7 .M32 (PP) 631.2\M222 McLaren, Arthur Douglas, 1917- Soil biochemistry 1967- 66027705 //r75 0824714660
S605.5 .E366 1994   Economics of organic farming : an international perspective c1994 gb 95018953 085198911X
S619\.S33 E93\1996   Evapotranspiration and irrigation scheduling : proceedings of the international conference, November 3-6, 1996, San Antonio Convention Center, San Antonio, Texas c1996 96086805 0929355822
S621.5.S8 L36   Land reclamation and biomass production with municipal wastewater and sludge c1982 82080452 0271003146
S62734 A12t Smith, Mimi, 1942- This is a test c1983 82051221 0898220319
SB\611\.5 .I61\1991 International Workshop on Biological Control of Chromolaena Odorata (2nd : 1991 : Bogor, Indonesia) Proceedings of the Second International Workshop on Biological Control of Chromolaena Odorata : Bogor, Indonesia, 4-8 February 1991 1991 92940991  
SB191 M2\E2 East, Edward M. (Edward Murray), 1879-1938 Inheritance in maize 1911]  
SB205.S7 W56 1981 Windish, Leo G. (Leo Gilbert), 1909- Soybean pioneers : trailblazers, crusaders, missionaries c1981 81211886  
SB292\.A2 P49\1991   Phytochemical induction by herbivores c1991 90024394 0471632414
SB354.5 .H57x\1976 (AND) SB354.5 .H57x\1976   History of fruit growing and handling in United States of America and Canada, 1860-1972   75016110  
SB359.4 .C87x\1998   Starting from seed : the natural gardener's guide to propagating plants c1998   1889538094
SB389 C69X\1988\(LC) Cox, Jeff, 1940- From vines to wines : the complete guide to growing your own grapes and making your own wine 1988   0882665286
SB41 .A25 no.487 International Symposium on Processing Tomatoes (6th : 1998 : Pamplona, Spain) Sixth International ISHS Symposium on the Processing Tomato : [and the] Workshop on Irrigation and Fertigation of Processing Tomato : Pamplona, Spain, 25-29 May, 1998 c1999   9066058412
SB415 .C37 1986   Carbon dioxide enrichment of greenhouse crops 1986 85016648 0849356113
SB455.3 .S95 2001 (NjP anxa)   Sweet breathing of plants : women writing on the green world 2001 00057862 0865475598
SB473 .O44 1990 Oehme, Wolfgang, 1930- Bold romantic gardens : the New World landscapes of Oehme and van Sweden 1990 90000081 0874919509
SB608.A6 M28 1996 MacHardy, William E Apple scab : biology, epidemiology, and management c1996 95080654 0890542066
SB608.C17 T48 (ARBOR) SB608.C17 T48 Thorold, C. A Diseases of cocoa 1975 75318662 019854507X
SB608.R5 C65 1990 Conference on Pest Management in Rice, 1990 : London, England Pest management in rice : papers presented at the Conference on Pest Management in Rice, held at the Society of Chemical Industry, London, UK, 4-7 June 1990 1990 90036828 1851665145
SB608.W5 P47x 2001 (mann) Peterson, Paul D. (Paul David), 1959- Stem rust of wheat : from ancient enemy to modern foe c2001 08006665 0890542716
SB608\.A6 M28\1996 \Quarto\ MacHardy, William E Apple scab : biology, epidemiology, and management c1996 95080654 0890542066
SB611 .P55x\1995   Plant invasions : general aspects and special problems c1995   9051030975
SB613.5 .P52 1998 (CSt BIOLOGY STACKS)   Plant invasions : ecological mechanisms and human responses 1998   9057820056
SB950.2.A1 F88 2000 (ICU JCL Sci)   Future role of pesticides in US agriculture c2000 00011245 0309065267
Sc D 98-2496 Desimone, Laura M Comparing the relationship of parent involvement and locus of control to adolescent school achievement [microform] : an analysis of racial/ethnic and income differences 1996  
Sc D 99-2181 Helper, Laura Whole lot of shakin' going on : an ethnography of race relations and crossover audiences for rhythm & blues and rock & roll in 1950s Memphis 1997  
Sc Micro R-4446 Ali, Kamal H Muslim school planning in the United States [microform] : an analysis of issues, problems and possible approaches 1981  
SD12.M4 G82 Massachusetts. Superintendent for suppressing the gypsy and brown-tail moths Annual report .. 1906- 08022396  
SD131 .M36x\1998 Mankin, William E Entering the fray : international forest policy processes : an NGO perspective on their effectiveness 1998  
SD223 .N38 1980 (LC) (FOR) National Symposium on "Improvement of Forest Biomass" (1980 : Solan, India) Improvement of forest biomass : symposium proceedings c1982 83904326  
SD223 .N47\1999   New moral economy for India's forests? 1999 99023263 0761993541
SD235.S67 D57 1996 (DANA)   Dipterocarp forest ecosystems : towards sustainable management c1996 96218292 9810227299
SD383 .P36 1997 Pakenham, Thomas, 1933- Meetings with remarkable trees c1997 96043550 0679456929
SD414\.T76 B34x\2001 \Quarto\   Balance between biodiversity conservation and sustainable use of tropical rainforests 2001   9051130503
SD575 .F674 1999   Forest resource policy in Latin America 1999 99071560 1886938342
Serial Federation of American Societies for Experimental Biology Federation proceedings    
Serials\P   Psyche : eine Zeitschrift für Tiefenpsychologie und Menschenkunde in Forschung und Praxis    
SF281 .M58 1999 Mills, D. S Equine behaviour : : principles and practice 1999 98055558 0632048786
SF408 .W55 1996 (SZ)   Wild mammals in captivity : principles and techniques 1996 95021376 0226440028
SF459.P7 P77 1995   Primate care : a handbook [1995] 96215979  
SF768.2\.H67\I57y\1986 International Conference on Equine Exercise Physiology (2nd : 1986 : San Diego, Calif.) Equine exercise physiology 2 : proceedings of the second International Conference on Equine Exercise Physiology, San Diego, California, August 7-11, 1986 1987 87081476 0961895004
SF780.4 .V59 1990 (VET) SF780.4 .V59 1990   Virus infections of ruminants 1990 90229645 0444873120
SF810.7.T79 P76 1999 (ICU JCL Sci)   Problem snake management : the habu and the brown treesnake c1999 98015664 0801435072
SF810.A3 M33 1986 (VET)   Manual of veterinary parasitological laboratory techniques 1986 gb 88023202 0112427243
SF84.6 .C66x\1997   Conservation and the use of wildlife resources 1997 96072148 0412713500
SF85.35.S88 L58 2000 (PU vanp)   Livestock management in the American Southwest : ecology, society, and economics 2000 00037554 0444503137
SF85.35\W4 +D34X\1995\(LC) Dagget, Dan, 1944- Beyond the rangeland conflict : toward a West that works c1995 95011727 0966622901
SF910.P34 A55 1992   Animal pain 1992 91031402 0443087725
SH 464 .R63 O78 1999 (LEE) Osthoff, Rich Fly-fishing the Rocky Mountain backcountry c1999 98026356 0811727661
SH1 .A47 (MUSM) SH1 .A47 (NAT) SH1 .A47 American Fisheries Society Monograph 1976- 76011293  
SHA (Catholic charities\review.)   Catholic charities review   a 42002239  
SK355 .T72 (SZ)   Translocation of wild animals 1988  
SSGC (Chavarría, J. M. Escuela normal y la cultura argentina) Chavarría, Juan Manuel Escuela normal y la cultura argentina [1947] a 48008347  
Study Non-circulating PQ2637.C736 T5 1979 (NNU Bobst REF1) PQ2637.C736 T5 1979 (NNU Bobst) Schwarz-Bart, Simone Ti Jean L'horizon : roman c1979 79127531 2020049937
Study Non-circulating PQ7797.S214 S6 1986 (NNU Bobst REF1) PQ7797.S214 S6 1986 (NNU Bobst) PQ7797.S214 S6 1986 (NNU Bobst) Sábato, Ernesto R Sobre héroes y tumbas ; [novela, por] [1967] 68048333  
STX (Argentina Republic. Justicia e Instrucción Pública, Ministerio de. Antecedentes sobre enseñenza secundaria) Argentina. Ministerio de Justicia é Instrucción Pública Antecedentes sobre enseñenza secundaria y normal en la República argentina .. 1903 07037172  
STY (Justicia) (Argentine Republic. Ministerio de justicia e instrucción pública. Reformas orgánicas) Argentina. Ministerio de Justicia e Instrucción Pública Reformas orgánicas en la enseñanza pública . 1916  
Stz Per 1/45/1985 (NeAmISG IISG Reading Room) Green, Nancy L Socialist anti-semitism, defense of a bourgeois Jew and discovery of the jewish proletariat : changing attitudes of french socialists before 1914    
Stz Per 1/45/1985 (NeAmISG IISG Reading Room) Green, Nancy L Socialist anti-semitism, defense of a bourgeois Jew and discovery of the jewish proletariat : changing attitudes of french socialists before 1914    
T C16bop (LAW) Canada. Bureau of Management Consulting Operation compulex; information needs of the practicing lawyers [1972] 74182107  
T\14\.5 .S68\1994 \+\   Image of technology in literature, the media and society 199?  
T\57\.85 .N456x\1995   Network models 1995 95175001 0444892923
T14.5 .C663 1992   Consuming technologies : media and information in domestic spaces 1992 91043743 0415069904
T174.7 .B56 1997 (PU engi)   Biological molecules in nanotechnology : the convergence of biotechnology, polymer chemistry and materials science c1998   1579361099
T1993\.F421 Fett, Darlene L Adolescent female voice : the effect of vocal skills instruction on measures of singing performance and breath management 1993  
T1996\.Z245 Zambrano, Wa-kí Frazer de El discurso colonial/postcolonial y el erotismo en las novelas de dos escritoras : reedicion del encuentro, conquista y colonizacion de America 1996  
T385 .H549\1990 Hill, Francis S Computer graphics c1990 89031610 0023548606
T3R70L   Court of Arches, Minute Book    
T49.5 .T4454 1998 (CSt ENG STACKS)   Technology management handbook c1999 [i.e. 1998] 98022328 0849385776
T500 S67 (MAIN) Snider, Denton Jaques, 1841-1925 World's fair studies 1895 05030121  
T500.B1 B88 1988 (AVE) AA6750 C4 B93 Burnham, Daniel Hudson, 1846-1912 Final official report of the Director of Works of the World's Columbian Exposition 1989 88024458 0824037235
T57.7.I574 1990 (ICU Eck Eck)   Integer programming and combinatorial optimization : proceedings of a conference held at the University of Waterloo, May 28-30 1990, by the Mathematical Programming Society c1990 cn 90094335 088898099X
T57.95 .F56 (NNU Courant) T57.95 .F56 (NNU Bobst) T57.95 .F56 (NNU Bobst) T57.95 .F56 (NNU Bobst) T57.95 .F56 (NNU Bobst) Fishburn, Peter C Utility theory for decision making [1970] 74107587 0471260606
T58.6 .L376 2000 (NNU NYU Bobst) Laudon, Kenneth C., 1944- Management information systems : organization and technology in the networked enterprise 2000 99016968 0130117323
T60.8 .P39 1998 Parker, Sharon Job and work design : organizing work to promote well-being and effectiveness c1998 98008932 0761904190
T60.8 .P39 1998 (NNU Bobst) Parker, Sharon Job and work design : organizing work to promote well-being and effectiveness c1998 98008932 0761904190
TA140.S8A3 (ICU JCL Sci) Stevens, John F. (John Frank), b. 1853 Engineer's recollections 1936] 36009570  
TA1634 .S48 2001 (CSt GREEN STACKS) Shapiro, Linda G Computer vision c2001 00066556 0130307963
TA1634 .T78 1998 (NNCoo CU Cooper) Trucco, Emanuele Introductory techniques for 3-D computer vision c1998   0132611082
TA1634 .T783x 1998 (P) Trucco, Emanuele Introductory techniques for 3-D computer vision c1998   0132611082
TA1750 .H38 1984 (SCI) Haus, Hermann A Waves and fields in optoelectronics c1984 83008645 0139460535
TA1800 .I528 1998 (PHYS)   Infrared fiber optics 1998 97039324 0849324890
TA331 .C47 2000 (TECH) Chirikjian, Gregory S Engineering applications of noncommutative harmonic analysis : with emphasis on rotation and motion groups 2000 00031236 0849307481
TA401 .M4385   Materials science forum 1984-  
TA401.3 .M3793 (ICU JCL Sci)   Materials science forum 1984- 86642954  
TA405 .P54 1991 ((FTaSU) sci) Pisidhi Karasudhi Foundations of solid mechanics c1991 90048510 0792307720
TA407 .H41+ 1960 (PHYSC) TA406.7 .H54+ 1960 Herdan, Gustav Small particle statistics; an account of statistical methods for the investigation of finely divided materials. With a guide to the experimental design of particle size determinations 1960 6015034/l/r842  
TA410 .S57 1998 Singer, J Buckling experiments : experimental methods in buckling of thin-walled structures c1998- 96052326 0471956619
TA418.9.C6 H8 (ENG) Hull, Derek Introduction to composite materials 1981 80042039 0521239915
TA418.9.P6 M48 1999 (PU math)   Methods in the physics of porous media c1999   0124759823
TA420 .O42 (MAIN) (DISS) O'Halloran, Michael Reid Curvilinear stress-strain relationship for wood in compression 1973  
TA455.C43 W38 1996 Watchman, John B., 1928- Mechanical properties of ceramics c1996 95036612 0471133167
TA460 B76 Brown, William F., 1922- Plane strain crack toughness testing of high strength metallic materials [c1966] 66029517 //r84  
TA647 .C75\1991 Crisfield, M. A Non-linear finite element analysis of solids and structures c1991-c1997 90027815 //r97 0471929565
TA654.6 .C466 2001 Chopra, Anil K Dynamics of structures : theory and applications to earthquake engineering c2001 00042751 0130869732
TA660.P6 W46\1987 Whitney, James Martin, 1936- Structural analysis of laminated anisotropic plates c1987 87050430 0877625182
TA660\.P6 B55\2001 Bloom, Frederick, 1944- Handbook of thin plate buckling and postbuckling 2001 00050441 1584882220
TC401 .I12 1975 (GTLAK) IFIP Working Conference on Biosystems Simulation in Water Resources and Waste Problems, Bruges, 1975 System simulation in water resources : proceedings of the IFIP working conference on Biosystems simulation in water resources and waste problems, [Bruges, Belgium, September 3-5, 1975] 1976 76370844 0444110933
TD1 665 (ICU JCL SciDDC) Radley, Jack Augustus Photography in crime detection 1948 49020239  
TD171 .N36 1995 National Academy of Public Administration Setting priorities, getting results : : a new direction for the Environmental Protection Agency [1995] 95068048  
TD196\.P4 H93\1994   Hydrocarbon bioremediation c1994 94002907 //r94 0873719840
TD482 .C474 1995 Cesario, Lee Modeling, analysis, and design of water distribution systems c1995 95139177 0898677580
TD482 .C58 1998 Clark, Robert Maurice Modeling water quality in drinking water distribution systems 1998 98036443 0898679729
TD665 .I61 1984 International Conference on Urban Storm Drainage (3rd : 1984 : Göteborg, Sweden) Proceedings of the Third International Conference on Urban Storm Drainage, Göteborg, Sweden, June 4-8, 1984 1984   9170321280
TD746 .E53   Emergency planning for municipal wastewater facilities 1989 89039334 0943244463
TD756.5 .T73 2001g   Transformations of nutrients in natural and constructed wetlands 2001   9057820765
TD758.5.H43 M5 1981a (ENG) Minear, R. A Data base for influent heavy metals in publicly owned treatment works 1981?]  
TD889 D485X\1999\(LC) Devinny, Joseph S Biofiltration for air pollution control c1999 98035184 1566702895
TD893.6.T7 T731 1987   Transportation noise reference book 1987 86029944 0408014466
TD930 .A55 1995 (TECH)   Animal waste and the land-water interface c1995 95009411 1566701899
TDRA [See shelving note] American Federation of Labor Report of proceedings of the ... annual convention of the American Federation of Labor .. 1882- 08023471  
TE1 .H54 no.1670   Transportation and environment 1999   0309070708
TG151 .B75 1978 British Standards Institution Steel, concrete, and composite bridges c1978-  
TG6\Y12\O\Ar23\Xar2 Archer, Cathaline Alford John Clark Archer, a chronicle 1959] 59038179  
TH 4815 .S395 2000 (LEE) Scutella, Richard M How to plan, contract, and build your own home c2000 99035570 0071346090
TH7975.D8 M33 Maril, Nadja American lighting, 1840-1940 c1989 89084163 //r90 0887401775
Thesis\1973\N522 (MANX2) Thesis\TX295\1973\N522 Nevill, Gayle, 1947- Impact of television advertising on children's food opinions and practices: an exploratory study 1973  
Thesis\1974\S5312 (MANX2) Thesis\TX295\1974\S532 Sharaga, Susan Joy, 1948- Effect of television advertising on children's nutrition attitude, nutrition knowledge and eating habits 1974  
Thesis\1977\A419 (MANX2) Thesis\TX295\1977\A434 Allardice, Barbara Schaefer, 1939- Development of representational skills for some mathematical concepts 1977  
Thesis\1978\S348 (MANX2) Thesis\TP372\1978\S348 Schmidl, Mary Katherine, 1951- Production, characterization, ultrastructure, and functional properties of egg albumin and corn zein plastein reaction products and their insoluble fractions 1978  
Thesis\1982 Nurik, Tracey Sue Study of Elisabetta Sirani and her works in American colletions 1982  
Thesis\1996\S931 (MUSIC) Thesis\ML\30\1996\S931 \+\ Stuart, Kathryn Marks of emphasis in Beethoven piano sonatas 1996  
Thesis\1996\S931 (MUSIC) Thesis\ML\30\1996\S931 \+\ Stuart, Kathryn Marks of emphasis in Beethoven piano sonatas 1996  
Thesis\1999\F542 (MUSIC) Thesis\ML\30\1999\F542 \+\ Field, Elizabeth I Performing solo Bach : an examination of the evolution of performance traditions of Bach's unaccompanied violin sonatas from 1802 to the present 1999  
Thesis\D\13\.9\1998\C654 \+\ (ARCHV) Thesis\1998\C654 Cole, Simon Ablon, 1967- Manufacturing identity : a history of criminal identification techniques from photography through fingerprinting c1998  
Thesis\D\212\1994\T925 \+\ (ARCHV) Thesis\1994\T925 Tumpek-Kjellmark, Katharina C., 1957- From Hitler's widows to Adenauer's brides : towards a construction of gender and memory in postwar West Germany, 1938-1963 1994  
Thesis\P30\1992\H921 \+\ (ARCHV) Thesis\1992\H921 Hume, Elizabeth Valerie Front vowels, coronal consonants and their interaction in nonlinear phonology 1992  
Thesis\PN\38\1993\S631 \+\ (ARCHV) Thesis\1993\S631 Slawney, James Jay, 1962- Phantom of reason : oneirocriticism from Baudelaire to Benjamin 1993  
TJ223 .M53 O48 2001 (CSt ENG STACKS)   Open control networks : LonWorks/EIA 709 technology c2001 2001032616 0792374061
TJ260 .B433 1996 (NNCoo Cooper) Bejan, Adrian, 1948- Thermal design and optimization c1996 95012071 0471584673
TJ260 .B87\1998 Burmeister, Louis C Elements of thermal-fluid system design c1998 97017164 0136602185
TJ755 .H45 1988 (BUEN) Heywood, John B Internal combustion engine fundamentals c1988 87015251 007028637X
TJ820 .G55 1999 Gipe, Paul Wind energy basics : : a guide to small and micro wind systems c1999 98054585 1890132071
TK 7874 .H82 1998 (LEE) Huang, Shi-Yu, 1965- Formal equivalence checking and design debugging c1998 98023993 079238184X
TK 7874 .H82 1998 (LEE) Huang, Shi-Yu, 1965- Formal equivalence checking and design debugging c1998 98023993 079238184X
TK145 .T5 1951 Timbie, William Henry, 1877- Principles of electrical engineering [1953,c1951] 51011758  
TK2901 .H36 1995   Handbook of batteries c1995 94029189 0070379211
TK5101 .K87 \+\ Kotel'nikov, V. A Theory of optimum noise immunity 1959 [c1960] 59009990  
TK5102.5 J615X\1993\(LC) Johnson, Don H Array signal processing : concepts and techniques 1993 92010476 0130485136
TK5103.2 .N44 2000 Nee, Richard van OFDM for wireless multimedia communications 2000 99052312 0890065306
TK5103.2 .P34 1995 (NNCoo Cooper) Pahlavan, Kaveh, 1951- Wireless information networks c1995 94022900 0471106070
TK5103.2 .Z35 2001 Zander, Jens Radio resource management for wireless networks c2001 00065068 1580531466
TK5103.59 .R36\1998 Ramaswami, Rajiv Optical networks : a practical perspective c1998 97046057 1558604456
TK5103.59 D88\1998\(LC) Dutton, Harry J. R Understanding optical communications c1998 99183122 0130201413
TK5103.7 .F36\1996 Fan, Pingzhi, 1955- Sequence design for communications applications c1996 96027607 047196557X
TK5103.7 .M486 1998 Meyr, Heinrich Digital communication receivers : : synchronization, channel estimation, and signal processing c1998 97017108 0471502758
TK5122 .N447 1989 (LC) (S) Neering, Rosemary Continental dash : the Russian-American telegraph 1989 cn 89091005 0920663079
TK5741\.F59 Fleming, J. A. (John Ambrose), Sir, 1849-1945 Principles of electric wave telegraphy 1906  
TK5984 .A38 1997   Acoustic wave sensors : : theory, design, and physico-chemical applications c1997 96021931 0120774607
TK7867 .S39 1998 (CSt ENG STACKS) Sedra, Adel S Microelectronic circuits c1998 97011254 0195116631
TK7868.D5 F53 1997 (TECH) Floyd, Thomas L Digital fundamentals c1997 96021933 0133984885
TK7871.15 .S56 S555 2001 (CSt ENG STACKS)   Silicon carbide--materials, processing and devices : symposium held November 27-29, 2000, Boston, Massachusetts, U.S.A. 2001 2001026701 1558995501
TK7871.15.P6 C37 1999 (PU engi) Chandrasekhar, Prasanna Conducting polymers, fundamentals and applications : a practical approach c1999 99037935 0792385640
TK7871.58\D54 W66x\1993\(LC) Wong, Thomas Tang Yum, 1952- Fundamentals of distributed amplification c1993 93031144 0890066159
TK7871.6 .C6 (COPM) Collin, Robert E Antenna theory [1969] 68008031 0070118000
TK7871.99\M44 L44X\1998\(LC) Lee, Thomas H., 1959- Design of CMOS radio-frequency integrated circuits 1998 97034158 0521630614
TK7872.F5 F37 1998 Farhang-Boroujeny, B Adaptive filters : theory and applications c1998 98008783 0471983373
TK7872\.F44 F46\1995   Ferroelectric polymers : chemistry, physics, and applications 1995 95015192 0824794680
TK7874.65 .R33 1996 (BUEN) Rabaey, Jan M Digital integrated circuits : a design perspective c1996 95022672 0131786091
TK7887.5 .S43 1998 Sells, Chris Windows telephony programming : a developer's guide to TAPI c1998 98020433 0201634503
TL 670 .U15 vol.1 (LEE)   U.S. civil aircraft : (ATC 1-ATC 100) 1962- 62015967  
TL220 .W343 1994 ((FTaSU) sci) Wakefield, Ernest Henry, 1915- History of the electric automobile : battery-only powered cars 1994 93032254 1560912995
TL724 .R45 1999 Reid, Constance Slacks and calluses : our summer in a bomber factory c1999 99031365 156098368X
TL789.5.N6 M33 1997 (ICU JCL Sci) McAndrew, James, 1963- Roswell report : case closed [1997] 97011361 0160490189
TN28 .U4 United States. Bureau of Mines Contributions to the data on theoretical metallurgy 1932- 32026705  
TP1175.E9 R37 1994 (PU town) Rauwendaal, Chris Polymer extrusion c2001 2001039609 1569903212
TP156.C8 F68 1995 Fouassier, Jean-Pierre, 1947- Photoinitiation, photopolymerization, and photocuring : fundamentals and applications 1995 94041200 1569901465
TP159.C46 T48 1997 Thompson, Michael, 1942- Surface-launched acoustic wave sensors : : chemical sensing and thin-film characterization c1997 96044729 0471127949
TP159.M4 F86 1996   Fundamentals of inorganic membrane science and technology 1996 97100976 0444818774
TP248.65.F66 C48 2001 ((FTaSU) sci) Charles, Daniel Lords of the harvest : biotech, big money, and the future of food c2001   0738202916
TP248.65.P76 P69 1997 (PU town)   Protein-based materials c1997 96028021 0817638482
TP248.65\.L54 M54x\1993 MIE BIOFORUM 93 (1993 : Toba City, Japan) Genetics, biochemistry and ecology of lignocellulose degradation : proceedings of MIE BIOFORUM 93 - Genetics, Biochemistry and Ecology of Lignocellulose Degredation - on November 17-19, 1993, Toba City, Japan [1993]   4946450130
TP371 .H26 1999 (ICU JCL Sci)   Handbook of food preservation c1999 98049271 0824702093
TP372.3 .M36\2000   Managing frozen foods 2000 00037817 0849308445
TP372.5 .M84\1973 Muller, H. G. (Hans Gerd), 1928- Introduction to food rheology [1973] 72081532 //r8 0844800139
TP372.5 .P76x\1993   Progress in flavour precursor studies : analysis, generation, biotechnology : proceedings of the International Conference, Würzburg, Germany, September 30-October 2, 1992 / editors, Peter Schreier, Peter Winterhalter c1993   0931710308
TP373.3 .F67 2000 (NNU NYU Bobst)   Food shelf life stability : chemical, biochemical, and microbiological changes [2000], c2001 00030424 0849389763
TP373.3 .F68 1998 (NNU Bobst)   Food storage stability c1998 97041662 084932646X
TP373.3 .S73\2000   Stability and shelf life of food 2000 00060864 0849308577
TP418 .I57\1992 International Haarmann & Reimer Symposium (3rd : 1992 : Kyoto, Japan) Recent developments in flavor and fragrance chemistry : proceedings of the 3rd International Haarmann & Reimer Symposium c1993 93136729 3527285350
TP451.E3 E35 1994 (NNU Bobst)   Edible coatings and films to improve food quality c1994 94060493 1566761131
TP548 .P4513 1984 (AMB) Peynaud, Emile Knowing and making wine c1984 84011936 047188149X
TP680 .E33\1990 \Quarto\   Edible fats and oils processing : basic principles and modern practices : world conference proceedings c1990 90001029 0935315306
TP680 .T35\1997   Technology and solvents for extracting oilseeds and nonpetroleum oils c1997 97042900 0935315810
TP692.4.N3 C37 1995 ((FTaSU) sci)   Catalytic naphtha reforming : science and technology c1995 94029127 082479236X
TP815 .F78 1994 Funk, James E., 1928- Predictive process control of crowded particulate suspensions : applied to ceramic manufacturing c1994 93032257 0792394097
TP991 .C39\1995 Cavitch, Susan Miller, 1959- Natural soap book : making herbal and vegetable-based soaps c1995 95006061 0882668889
TR140 H89 A4 1980   Souvenirs de Jersey 1852-1853 d1980  
TR385 .R443x 1996 (TYL) Reed, Martin Silver gelatin : a user's guide to liquid photographic emulsions 1996   0817458859
TR642 .T45 1982 (MAIN)   Thinking photography 1982   0333271955
TR647 .C684x\2001 Cox, Renée, 1958- Renee Cox : American family c2001   0944680658
TR660 .C655x 1999 (TYL) Collett, John Black & white landscape photography c1999   1584280042
TR680 .S62 1999 (PU fine) Sobieszek, Robert A., 1943- Ghost in the shell : photography and the human soul, 1850-2000 : essays on camera portraiture c1999 99025393 0262194252
TR680 +B49 1993 (LC) (ART) Bettina Bettina, Porträt-Photographie 1925-1990 c1993   385823396X
TR681 .W6 L56 1996 (CSt ART STACKS) Lindbergh, Peter 10 women c1996   3823814168
TR681.H65 D45 2001 (PU fine) Deitcher, David Dear friends : American photographs of men together, 1840-1918 2001 00062076 0810957124
TR820.H366 1999 (ICU DLL LawC) HANNIGAN, WILLIAM New York noir : crime photos from the Daily news archive 1999 99070709 0847821722
TS155.6 .S6373\1997   Solid freeform fabrication : a new direction in manufacturing : with research and applications in thermal laser processing c1997 96047010 //r97 0792398343
TS176 .I6385 1988 International Conference on Expert Systems and the Leading Edge in Production Planning and Control (2nd : 1988 : Charleston, S.C.) Expert systems and intelligent manufacturing : proceedings of the Second International Conference on Expert Systems and the Leading Edge in Production Planning and Control, held May 3-5, 1988 in Charleston, South Carolina c1988 88007130 0444013253
TS1892 .T7 1975 Treloar, L R G Physics of rubber elasticity 1975   0198513550
TS543.U6 H6 1975 (REFAR) Hoopes, Penrose R. (Penrose Robinson), 1892- Connecticut clockmakers of the eighteenth century 1975 75328515 0804811520
TS655 .P39 1995 Pawlowski, Lech Science and engineering of thermal spray coatings c1995 94019287 0471952532
TS655 .P39\1995 Pawlowski, Lech Science and engineering of thermal spray coatings c1995 94019287 0471952532
TS886.5.C45 C73 1998 (NNU NYU Bobst) TS886.5.C45 C73 1998 (NNCoo CU Cooper) TS886.5.C45 C73 1998 (NNNS NSSR Parsons) 749.32 C891 (NNSID NYSID NYIntDes) Cranz, Galen Chair : rethinking culture, body, and design c1998 97043898 0393046559
TT499 .S74 1995 (REFDK)   Standard table of body measurements for adult female misses figure type, sizes 2-20 [1994]  
TT505.L56 H49 1982 Lopez, Antonio, 1943-1987 Antonio's girls 1982 81071597 0930186087
TT506 .V4 Vecchio, Walter Fashion makers, a photographic record [1968] 67027050  
TT920 .S685 1999 (MAOVR) Speight, Charlotte F., 1919- Hands in clay c1999 98050031 0767405013
TX 631 .D49 2000 (LEE)   Dimensions of the meal : the science, culture, business, and art of eating 2000 99044079 0834216418
TX345 .F595 1983 \Quarto\   Food in motion : the migration of foodstuffs and cookery techniques : proceedings : Oxford symposium 1983 c1983 84186285 0907325157
TX353 .F675\1992   Food science reviews 1992- 92030466 0130273694
TX361.W55 W87   Woman's conflict : the special relationship between women and food c1980 79021299 //r82 0139619461
TX392 .V42\1996 \Quarto\   Vegan handbook : over 200 delicious recipes, meal plans, and vegetarian resources for all ages c1996 96060113 0931411173
TX543 .F59 1994 (NNU Bobst) Flint, Olga Food microscopy : a manual of practical methods, using optical microscopy 1994 gb 94088180 187274804X
TX571\.P4 K44\1998 \Quarto\ Kegley, Susan E., 1957- Pesticides in fruits and vegetables c1998 98010225 0935702466
TX649.R45 A3 2001 (PU vanp) Reichl, Ruth Comfort me with apples : more adventures at the table 2001 00053355 0375501959
TX945.5.H37 C55 1996 (NNU Bobst) Cipriani, Arrigo Harry's Bar : the life and times of the legendary Venice landmark 1996 95053077 1559702591
U21.2 .V57 (BUR) (LEH) Virilio, Paul Pure war c1983   0936756039
U33 .A76 1999 (PU vanp)   Armées et sociétés de la Grèce classique : aspects sociaux et politiques de la guerre aux Ve et IVe s. av. J.-C. c1999   2877721736
U33 .P7 (VPL)   Problèmes de la guerre en Grèce ancienne, Sous la direction de Jean-Pierre Vernant. [École pratique des hautes études, Sorbonne] 1968 [1969] 77403108  
U820.G7 W43 1989   Weapons and warfare in Anglo-Saxon England 1989   0947816216
UA700 .J3813 1972 (MAIN) Jaurès, Jean, 1859-1914 Democracy and military service; an abbreviated translation of L'armée nouvelle 1972 70147769//r83 0824004671
UA702 .G54 (BAKR) Girardet, Raoul La sociéte militaire dans la France contemporaine [1953] 54007919  
UA702 .O67 (VPL) Ordioni, Pierre Pouvoir militaire en France : de Charles VII à Charles de Gaulle c1981- 81130122  
UA702.F32 (ICU JRL Gen) Feller, Jean, 1921- Dossier de l'armée française, la guerre de cinquante ans, 1914-1962 [1966]  
UB173 .U58 United States. Adjutant-General's Office Adjutant General's Office 1978  
UB355.R96 B34 Baumann, Robert Fred Debates over universal military service in Russia, 1870-1874 1984  
Ukb19\884s Schellen, H. (Heinrich), 1818-1884 Magneto-electric and dynamo-electric machines: their construction and practical application to electric lighting and the transmission of power 1884 07027882  
Uncat Treas Heurlett, Maurice Ballad of "The Gloster" & "The Goeben".. 1914]  
Uxe729\939b Beaudza, Louis Formation de l'armée coloniale 1939 39033990  
V Zür (Sz) Hens, Szymon Phantasieprüfung mit formlosen Klecksen bei Schulkindern, normalen Erwachsenen und Geisteskranken : Aus der psychiatr. Klinik Zürich 1917  
Video\record\7892\VHS   Terror 2000 [videoreording] [1990]  
VYAF (Kopp, G. Two lone ships) Kopp, Georg Two lone ships, "Goeben" & "Breslau" [1931] 31033685  
WA785 S227 1983   Sanitation and disease : health aspects of excreta and wastewater management c1983 82020063 047190094X
WB340\P235b\1993 Park, Kinam Biodegradable hydrogels for drug delivery c1993 93060193 1566760046
WF600\J81L\1995 Jónsdóttir, Helga Life patterns of people with chronic obstructive pulmonary disease : isolation and being closed in 1995  
WG\20092 Avé-Lallemant, Eberhard Kategoriale Ort des Seelischen in der Naturwirklichkeit; eine Untersuchung auf der Grundlage der realontologischen Arbeiten von Hedwig Conrad-Martius 1959  
WH500\H689231\1999   Hodgkin's disease c1999 98055677 0781715024
WI310\C199\1989   Campylobacter pylori in gastritis and peptic ulcer disease c1989 89011008 0896401626
WI700\L783458\1994   Liver gene expression c1994 94027240 1570590974
Widener: Aus 80212.8 vol. 3-4 F   Monumenta Vaticana historiam regni Hungariµ illustrantia ... Vatikâani magyar okirattâar 1886-  
Wis Mss CH Isham, Ruth Eliza Wales Papers, 1880-1884, 1897-1900    
WL354\B8139\1994   Brain injury rehabilitation : clinical considerations c1994 92048433 0683032240
WM171\T7844\2001   Treatment of recurrent depression c2001 00069520 1585620254
WM203.5\H236\1997   Handbook of autism and pervasive developmental disorders c1987 87006104 0471812315
WN32\H251w Harshaw, Josephine Perfect When women work together : a history of the Young Women's Christian Association in Canada 1966 67104625  
WQ205\M718\1994   Molecular biology of the female reproductive system c1994 93030113 0122563654
WS350.8\.A8\S859\2001   Stimulant drugs and ADHD : basic and clinical neuroscience 2001 00025748 0195133714
WT30\A547r\1993 Anderson, Kathryn E. Hoehn Relative contribution of illness stress and family system variables to family quality of life during early chronic illness c1993  
WY153.5\L228p\1998 Lamendola, Frank Philip Patterns of the caregiving experiences of selected nurses in hospice and HIV/AIDS care 1998  
WY156\E56\1996 Endo, Emiko Pattern recognition as a nursing intervention with adults with cancer 1996  
WY87\T661n\1997 Tommet, Patricia Ann Nurse-parent dialogue : illuminating the pattern of families with children who are medically fragile 1997  
WZ100\C836W\1967 Wittmann, Anneliese Kosmas und Damian. Kultausbreitung und Volksdevotion (1967) 68110722  
XXKF4215.K45 1997 (ICU DLL Law) Kelman, Mark Jumping the queue : an inquiry into the legal treatment of students with learning disabilities 1997 97027488 0674489098
XXKF8915.W753 1994 (ICU DLL Law) Wright, Edward T Winning courtroom strategies c1994 93049652 0131251708
XXKJC2247.E886 1991 (ICU DLL Law)   European insider dealing : law and practice 1991 gb 91052084 0406115575
XXKJC544.8.E96 2000 (ICU DLL Law)   Excerptiones iuris : studies in honor of André Gouron 2000 00046450 1882239121
XXKJV3721.S36 1991 (ICU JRL Gen) Schnapper, Bernard Voies nouvelles en histoire de droit : la justice, la famille, la répression pénale, XVIème-XXème siècles 1991  
XXKJV3838.C538 1995 (ICU DLL Law) Chauvaud, Frédéric Juge, le tribun et le comptable : histoire de l'organisation judiciaire entre les pouvoirs, les savoirs et les discours, (1789-1930) c1995   2717829024
YRA (International congress for psychical research (3d : Paris : 1927) Compte rendu) International congress for psychical research (3d : Paris : 1927) Compte rendu du IIIème Congès international de recherches psychiques, à Paris, septembre-octobre 1927 1928  
Z 213 .B7 M4 1964 (LEE) Medina, José Toribio, 1852-1930 Imprenta en Bogotá : y La inquisición en Cartagena de Indias 1952  
Z\7164\.C93 B35z\1990 Baldin, K. E Rabochie potrebitel'skie kooperativy v Rossii : 1861-fevral' 1917 g. : perechen' organizatsii 1990 91222228 //r922 5201005632
Z1039.N76 B44 1995 Bell, David N., 1943- What nuns read : books and libraries in medieval English nunneries 1995 94027837 0879075589
Z118.A3 B4 v.14 Kaser, David, 1924- Book for a sixpence : the circulating library in American 1980 79004298 0910230145
Z286.E43 H46 2001 Henke, Harold, 1956- Electronic books and epublishing : a practical guide for authors c2001 2001020858 1852334355
Z325 M8X\2001\(LC)   Moving market : continuity and change in the book trade c2001 2001021025 1584560525
Z3277.T5 S5 (GLX) Sherlock, Kevin Bibliography of Timor : including East (formerly Portuguese) Timor, West (formerly Dutch) Timor and the island of Roti 1980   0908160534
Z668 .M347 1995 (NNU Bobst)   Mapping curricular reform in library/information studies education : the American mosaic 1995 95037925 1560247401
Z668.5 .P7x\1985 \Quarto\   Preservation education in ARL libraries 1985  
Z8132.5 .M377 1992 (BAKR) Martínez Masdeu, Edgar Bibliografía Julia de Burgos 1992  
ZA3153 .C66 1998 Conference on Information Seeking in Context (ISIC). (2nd : 1998 : Sheffield, UK) Exploring the contexts of information behaviour : : proceedings of the Second International Conference on Research in Information Needs, Seeking and Use in Different Contexts, 13-15 August 1998, Sheffield, UK. c1999   0947568751
Zc72\885pe Perrine, Henry E True story of some eventful years in grandpa's life    
ZDVD 1883 (CSt GREEN MEDIA-MTXT)   Out of the present [videorecording] 1996   1565802713
  AAPG studies in geology 1979-  
  Acute and procedure pain in infants and children c2001 2001039244 0931092396
  Advances in anatomy, embryology and cell biology   73645292  
  Advances in instructional psychology 1978- 78013400 0470265191
  Albanian identities : myth, narratives and politics 2001   1850655715
  Alberta butterflies 1995   0773216723
  Alcohol and glial cells [1994] 94193917  
  American freshman : thirty year trends, 1966-1996 c1997   187847720X
  American realism and the canon c1994 94011782 0874135249
  Annals of the New York Academy of Sciences   12037287  
  Annual yearbook of the American Education Finance Association c1980- sf 88019781  
  Antropologâia 1997, c1994 97194402 9502305981
  Approaches to the typology of word classes 2000 99055227 3110161028
  Arab Americans; studies in assimilation 1969  
  Archeolog    
  Ars and texnh : art and craft of the Graeco-Roman world from 450 B.C. to 600 A.D. c1989  
  Assays : critical approaches to medieval and renaissance texts 1985 80054059 0822935082
  Attachment processes in adulthood 1994   1853021725
  Autour d'Horace 1990  
  Back to basics : how to learn and enjoy traditional American skills c1981 80050373 0895770865
  Bartók studies c1976 76000257 /MN 0911772782
  Basic concepts of intercultural communication : selected readings c1998 98015278 1877864625
  Behavioral law and economics 2000   0521661358
  Bernini architect [videorecording] c1997  
  Biological diversity : balancing interests through adaptive collaborative management c2001 2001018419 0849300207
  Biology of salt tolerant plants c1995 95078802 0964826011
  Birmingham news 1894- sn 83016047  
  Black Athena : ten years after 1997   907206707X
  Bold words : a century of Asian American writing c2001 00068346 0813529654
  Boston evening journal 1872-1898 sn 85033514  
  Cahiers des droits de l'homme [microform]   sn 94080302  
  Cambridge history of the native peoples of the Americas 1996-2000 95046096 0521344409
  Cambridge history of the native peoples of the Americas 1996-2000 95046096 0521344409
  Catalogue du Musâee Bourdelle 1990   290178416X
  Challenging the therapeutic state : critical perspectives on psychiatry and the mental health system c1990   0930195051
  Changing reels : Latin American cinema against the odds c1997   0952563630
  Chicago evening journal 1861-1896 sn 82016386  
  Chicago sun-times c1959- sn 82014807  
  Childhood traumatic brain injury : diagnosis, assessment, and intervention c1997 97007468 0890797188
  Chitin handbook [1997]   8886889011
  Clavis Virgiliana; or A vocabulary of all the words in Virgil's Bucolics, Georgics, and „neid ... Compiled out of the best authors on Virgil, by several hands, in a method entirely new. For the use of schools, and the improvement of those who have ma 1819 30018112  
  Come out and play [sound recording] : American power pop I (1975-78) p1993  
  Community, unity, communion : essays in honour of Mary Tanner 1998   0715157566
  Cosmopolitan geographies : new locations in literature and culture 2001 00036590 0415925061
  Crime after crime 1999   0312967403
  Criminological theory : past to present : essential readings 1998 97033460 0935732918
  Cultural studies and communications 1996 95036959 0340652683
  Current Creek and Sage Creek beaver habitat management study areas : 1983 progress report (February 1983 - January 1984) [1984?]  
  Current trends in grades and grading practices in undergraduate higher education : the results of the 1992 AACRAO Survey [1994?] 94003195 092985120X
  Cybercultures reader 2000   0415183782
  D'Arcy Collection of the Communications Library of the University of Illinois at Urbana-Champaign [microform] 1987]  
  Dartmouth atlas of cardiovascular health care c1999   155648285X
  Dedicatory and opening ceremonies of the World's Columbian Exposition. historical and descriptive 1893 05028595  
  Deer and deer hunting   sn 78001740  
  Denver daily tribune   sn 82014227  
  Design and analysis of ecological experiments 2000 00035647 0195131878
  Designing successful transitions : a guide for orienting students for college c1993  
  Diamond, SiC and nitride wide bandgap semiconductors : symposium held April 4-8, 1994, San Francisco, California, U.S. 1994 94033153 1558992391
  Dipterocarp forest ecosystems : towards sustainable management c1996 96218292 9810227299
  Directory of indexing and abstracting courses and seminars c1998 98021546 1573870560
  Doctora Cecilia Grierson : homenaje pâostumo 1937  
  Dynamics of violence : processes of escalation and de-escalation in violent group conflicts c1999   3428099575
  Edinburgh journal of botany 1990- 90648365  
  Education for national integration and development : report of Education Policy Review Commission    
  Emotion, development, and self-organization : dynamic systems approaches to emotional development 2000 99048061 052164089X
  Encyclopedia of herbs and herbalism [1981], c1979 81009750 0517353261
  Encyclopedia of team-building activities c1991 90048873 0883902575
  English pilot 1967 map68000508  
  Enterprising nation : renewing Australia's managers to meet the challenges of the Asia-Pacific century : managing for diversity 1995   0644432330
  Enterprising nation : renewing Australia's managers to meet the challenges of the Asia-Pacific century : report of the Industry Task Force on Leadership and Management Skills. Executive summary 1995   0644431261
  Enterprising nation : renewing Australia's managers to meet the challenges of the Asia-Pacific century. International best practice in leadership and management development 1995   0644430567
  Enterprising nation : renewing Australia's managers to meet the challenges of the Asia-Pacific century. Research report 1995   064443127X
  Enterprising nation : renewing Australia's managers to meet the challenges of the Asia-Pacific century. The Australian manager of the 21st century c1995   0644432349
  Environmental governance : a report on the next generation of environmental policy c2002 2001005927 0815702558
  Environmental value of riparian vegetation 1996]  
  Environments of south Florida, present and past : II 1984  
  ERIC [documents on microfiche] 1966-  
  Escuela, historia y poder : miradas desde Amâerica Latina 1996 (1997 printing) 98107263 9879116097
  Essays on Bangalore [microform] 1985 95900803  
  Estudios de historia colonial 1993 94235633  
  Ethnic notions : Black images in the white mind : an exhibition of Afro-American stereotype and caricature from the collection of Janette Faulkner : September 12-November 4, 1982 c1982 82001314 0942744004
  Everyman's Book of classic horror stories 1976   0460011588
  Evraziæiskaëiìa khronika   51050763  
  Evraziæiskaëiìa khronika   51050763  
  Evraziæiskiæi vremennik 1923-1927 48034733  
  Folklore preprint series   sc 81004047  
  Forensic neuropsychology : fundamentals and practice c1999 99022363 9026515448
  Frauen in der Geschichte IV : Wissen heisst leben-- : Beitrèage zur Bildungsgeschichte von Frauen im 18. und 19. Jahrhundert 1983   3590180234
  Global development finance ... CD-ROM [electronic resource] c1997- sn 97020049  
  Grandeur and obedience [videorecording] ; The light of experience 1993   0780013050
  Handbook for restoring tidal wetlands c2001 00030410 084939063X
  Handbook of discourse analysis 2001 2001018139 0631205950
  Handbook of literacy and technology : transformations in a post-typographic world 1998 97042351 0805826424
  Handbook of neuropsychology <2000-2001 > 00045467 0444503765
  Handbook of pain syndromes : biopsychosocial perspectives [1998], c1999 98036687 //r98 0805826807
  Handbook of solid waste management c1977 76020505 //r78 0442295502
  Harms way : lust & madness, murder & mayhem : a book of photographs c1994   0944092284
  Haydn, the innovator : a new approach to the string quartets c2000   1900072378
  Historia de lo que no ha sucedido : la guerra de 1895-96 1895  
  Historienbibel : Farbmikrofiche : Edition der Handschrift Hamburg, Staats- und Universitätsbibliothek, Cod. 8 in scrinio 1997   389219047X
  Homenaje a Manuel Ramos Otero, 1948-1990 [1992?]  
  Human rights in the teaching of the Church : from John XXIII to John Paul II : collection of texts of the Magisterium of the Catholic Church from Mater et magistra to Centesimus annus (1961-1991) 1994, c1993   8820918706
  IARC scientific publications   sn 83004798  
  Improving training effectiveness in work organizations c1997 96018085 080581387X
  India : another millennium? 2000 00289440 0670896454
  Industria azucarera en marcha [1955?] 85842423  
  Innovation and tradition : essays on Renaissance art and culture 2000   8878903841
  Innovations in clinical practice c1982- sn 83000536  
  Inside the law schools : a guide by students for students 1998 97038139 0452279461
  Inside the law schools : a guide by students for students 1998 97038139 0452279461
  Integrated resource assessment and management plan for Western District, Marsabit, Kenya 1983-1984 84983300  
  Integrating archaeological demography : multidisciplinary approaches to prehistoric population c1997 96083230 0881040819
  Integrating social sciences with ecosystem management : human dimensions in assessment, policy, and management c1999 99066154 1571672478
  International journal of clinical neuropsychology 1984-1990 sn 84012258  
  International management : a reader c1995   0030990157
  Introduction to latent variable growth curve modeling : concepts, issues, and applications 1999 98041005 080583060X
  Jerusalem report 1990- 91640884  
  Journal of chemical ecology   75644091  
  Journal on excellence in college teaching c1990- 91662200  
  Julia de Burgos 1986  
  Kitchen cooks, plate twirlers & troubadours : writing program administrators tell their stories c1999 98054813 0867094567
  Komplektovanåie krasnoæi armåii 1926  
  Laranja : análise e perspectivas 1978 83202464  
  Latin for the 21st century : from concept to classroom c1998   0673576086
  Lenguas de Panamâa 1974-<1980 > 75546130  
  Lenguas de Panamâa 1974-<1980 > 75546130  
  Liber amicorum : études offertes à Pierre Jaubert, Professeur émérite à la Faculté de droit des sciences sociales et politiques de l'Université de Bordeaux I c1992  
  Libro azul de Santo Domingo : Dominican blue book, 1920 [Pub. por la Compaänia biografica, subsidiaria de la Pan-American publicity corporation] 1920]  
  Linguistics in the Netherlands 1992 1992   9027231524
  Linguistics in the Netherlands 1993 c1993   9027231532
  Literally speaking : [sound poetry & text-sound composition 1993   9188316041
  Losing ground : lessons from the repeal of nine "Litte Davis-Bacon" acts [1995]  
  Maritime history 1996-<1997 > 9424805//r972 1575240130
  Materials science forum 1984- 86642954  
  Matteo Bandello, novelliere Europeo : atti del Convegno Internazionale di Studi, 7-9 novembre 1980 1982  
  Measurement of stress, trauma, and adaptation c1996 96009819 1886968020
  Medieval hagiography : an anthology 2001 2001041842 0415937531
  Memphis press-scimitar   sn 86071112  
  Mental disorder, work disability, and the law 1997 96010971 0226064506
  Mental retardation and developmental disabilities   73647002  
  Meridian star   sn 84020112  
  Miami herald [microform]    
  Mighty engine : the printing press and its impact 2000 00040656 187304061X
  Modern American women : a documentary history c1997 96022486 0070715270
  Modern plastics encyclopedia/89 1988  
  Modern theories of measurement : problems and issues c1994   096989810X
  Molecular cell biology c2000 99030831 0716731363
  Mycota : a comprehensive treatise on fungi as experimental systems for basic and applied research 1994-<c2001> 94019413 3540577815
  Na putiakh; utverzhdenie evraziitsev 1922 49031605  
  Neurobiology of the neurotrophins 2001   1929675011
  New England farmer, and horticultural register 1839-  
  Newry Bridge, or, Ireland in 1887 [microform] 1886  
  Newspaper clippings [1888?]  
  Nonverbal communication reader : classic and contemporary readings c1999 99461869 1577660404
  Nonverbal communication reader : classic and contemporary readings c1999 99461869 1577660404
  Norton anthology of English literature c2000- 99043298 0393974863
  Nutritional perspectives   sc 78000940  
  Overrated/underrated : 100 experts topple the icons and champion the slighted c2001 2001025730 1579121632
  Parsnips in the snow : talks with Midwestern gardeners 1990 89020439  
  Personal narratives : women photographers of color : Lorraine O'Grady, Coreen Simpson, Lorna Simpson, Clarissa T. Sligh, Carrie Mae Weems, Pat Ward Williams, Deborah Willis at the Southeastern Center for Contemporary Art c1993 93061698 0961156015
  Petersen's photographic [1979- 97657679  
  Physiology, biochemistry, and molecular biology of plant lipids c1997 96052352 0792343794
  Political Catholicism in Europe, 1918-1965 1996 95025450 0198203195
  Politiques de l'habitat : 1800-1850 1977 79373216  
  Probláemes mathâematiques de la thâeorie des automates : sâeminaire M. P. Schèutzenberger, A. Lentin et M. Nivat, annâee 1969/70, Facultâe des sciences de Paris, Institut Henri Poincarâe 1970 75514256  
  Problemi di critica goldoniana c1994 94182611//r95 8880630067
  Protocols for short term toxicity screening of hazardous waste sites 1988  
  Psychology & health 1987- 87641474  
  Puerto Rico desde el cielo [1995] 2001354203  
  Quality in health care : theory, application, and evolution 1995 94044355 0834206250
  Raison d'Etat : politique et rationalité 1992   2130445888
  Recusant translators : Elizabeth Cary and Alexia Grey c2000 99055940 184014226X
  Reference materials of the European communities : results of hemocompatibility tests c1992 92030458 0792320026
  Religious life of young Americans : a compendium of surveys on the spiritual beliefs and practices of teen-agers and young adults c1992 92070599  
  Rethinking development in East Asia and Latin America [1997]  
  Retired NBME basic medical sciences test items c1991  
  Reviews in environmental health, 2001 2001  
  Revue des études juives [microform] 1880-  
  Richmond times-dispatch 1914- sn 83045389  
  RNA-ligand interactions c2000   0121822184
  RNA-ligand interactions c2000   0121822184
  Robert Colescott [videorecording] c1991  
  Rocznik Towarzystwa Heraldycznego we Lwowie 1910-  
  Rocznik Towarzystwa Heraldycznego we Lwowie 1910-  
  Rossiia i latinstvo 1923  
  Rules for reasoning 1993 92039042 0805812563
  Safe schools : a handbook for practitioners c1995   0882103040
  SAS language guide c1988   1555440916
  Schur lectures (1992) 1995 96157904  
  Season of migration to the North by Tayeb Salih, a casebook c1985  
  Self-conscious emotions : the psychology of shame, guilt, embarrassment, and pride c1995 94031710 0898622646
  Self-conscious emotions : the psychology of shame, guilt, embarrassment, and pride c1995 94031710 0898622646
  Selma times-journal 1920- sn 86050387  
  Setting the agenda : management reform in Australia : a discussion paper concerning Enterprising nation, the report of the Industry Task Force on Leadership and Management Skills 1995   085857053X
  Sexual predator : law, policy, evaluation, and treatment c1999 99072667 1887554092
  Shakaiteki sogo koi no kenkyu 1987 88135186 /AJ  
  Shake it up! [sound recording] : American power pop II (1978-1980) p1993 93853320  
  Silicon carbide : a review of fundamental questions and applications to current device technology 1997   3055017927
  Slow food : collected thoughts on taste, tradition, and the honest pleasures of food c2001 2001053680 1931498016
  Social identity and intergroup relations 1982 81021676 0521246164
  Social role and evolution of the teaching profession in historical context : conference papers for the 10th session of the International Standing Conference for the History of Education, Joensuu 25-28 July 1988, Finland 1988 89147323 9516967582
  Social support and cardiovascular disease c1994 93020980 0306439824
  Sociological methodology   68054940  
  Solid state physics : advances in research and applications 1955- 55012299  
  Sovremennoe prochtenie Pushkina : mezhvuzovskii sbornik nauchnykh trudov 1999 00299555 5780701008
  SPE paper [microform]    
  Sports medicine handbook 1999   0727910310
  St. Louis post-dispatch   sn 83045501  
  Starting an indexing business c1998   1573870749
  State-of-the-art report : biological warfare agent detection technologies 1995   1888727020
  Stemming the tide of coastal fish habitat loss : proceedings of a symposium on conservation of coastal fish habitat, Baltimore, Maryland, March 7-9, 1991 1992  
  Subaltern studies : writings on South Asian history and society : 3rd Conference : Papers 1992   0195630181
  Survey methodology bulletin [microform] [1977-  
  Survey methodology bulletin [microform] [1977-  
  Survey methodology bulletin [microform] [1977-  
  Survey methodology bulletin [microform] [1977-  
  Survey methodology bulletin [microform] [1977-  
  Survey methodology bulletin [microform] [1977-  
  Surveys in differential geometry c1991- sn 90004860  
  Taisho toshi Parumira no tonan bochi no chosa to kenkyu 1998 99138584 4916071298
  Teaching of Latin in American schools : a profession in crisis c1987 87012678 1555401503
  Teatro para el teatro 1989- 91641774  
  Techniques in insect immunology c1998   1887052054
  Temas de Jacques Lacan 1971]   9500621007
  Town bloody hall [videorecording] : a dialogue on women's liberation c1979  
  Toxicological profile for polycyclic aromatic hydrocarbons [1995]  
  Traffic control systems handbook 1996]  
  Traffic control systems handbook [microform] [1996]  
  Transactions of the American Philosophical Society ..   12030301  
  Trust and citizen engagement in metropolitan Philadelphia : a case study [1997] 97206888  
  U.S. pet ownership & demographics sourcebook c1997 97072094 1882691024
  Urban ecosystems c1997- 97643340  
  Vecherniaia Moskva : gazeta Moskovskogo gorodskogo komiteta KPSS i Mossoveta   sn 92028046#  
  Vivir en la frontera : la casa, la dieta, la pulpería, la escuela (1770-1870) 2000   9507862714
  Women, politics, and American society c2002 2001050439 0321100433
  World's fair : or Columbian exposition, Chicago, May to November [1893]  
  Writing and selling the romance novel c1983 83006859 0871161346
  WT50 : a tribute to Weird tales 1974]  
  Your first romance c1984 83021256 0312897901
  Zora is my name! [videorecording] 1989  
  Abbate, Elizabeth Teoli Myth, symbol, and meaning in Mahler's early symphonies 1996  
  Abel, Maria Gertrud, 1904- Versuch einer erkenntnistheoretischen Grundlegung der Geschichtsphilosophie .. 1938  
  Abraham, Carolyn Possessing genius : the bizarre odyssey of Einstein's brain 2002 2001048604 031228117X
  Ackerman, Marc J Does Wednesday mean mom's house or dad's? : parenting together while living apart c1997 96018380 0471130486
  Ackerman, Marc J Does Wednesday mean mom's house or dad's? : parenting together while living apart c1997 96018380 0471130486
  Adams, Clementina R Common threads : themes in Afro-Hispanic women's literature 1998 96061937 0897298276
  Adams, Robert Harold Songs of our grandfathers: music of the Unami Delaware Indians 1977  
  Adelson, Jordan M Evaluation of geochemical indicators of anoxia in the Chesapeake Bay 1997  
  Ahlin, Lars, 1946- Principles of wireless communications c1998   9144314213
  Akerman, James R On the shoulders of a Titan : viewing the world of the past atlas structure 1991  
  Albert, Thomas Milton Reformation of the Renaissance(s) : literary "renaissances" and national identity in England, the United States, and Portugal 1989, c1990  
  Albom, Mitch, 1958- Tuesdays with Morrie : an old man, a young man, and life's greatest lesson c1997 96052535 0385484518
  Alderman, Tracy Scarred soul : understanding & ending self-inflicted violence c1997 97066073 1572240792
  Aleandri, Emelise Italian-American immigrant theatre of New York City 1999   0738500976
  Algemene Vereniging voor Taalwetenschap (Netherlands). Meeting (27th : 1996 Utrecht) Linguistics in the Netherlands 1996 1996   1556192207
  Al-Harthy, Ali Salim M Reliability analysis and reliability based design of prestressed concrete structures 1992  
  Altenbaumer, James Edward The salvation myth in the hymns in Revelation 1992  
  Ambelain, Robert Au pied des menhirs; introduction áa l'âetude des doctrines celtiques 1945 af 47006829  
  Ambelain, Robert Dans l'ombre des cathâedrales 1939 39014174  
  American Academy in Rome Maya Lin c1998   8843568329
  American Society of Indexers. Meeting (22nd : 1990 : Chicago, Ill.) Indexing tradition and innovation : proceedings of the 22nd Annual Conference of the American Society of Indexers, June 27, 1990, Chicago c1991 91032196 0936547138
  American Sociological Association. Meeting (82nd : 1987 : Chicago, Ill.) 1987 program : eighty-second Annual Meeting, Palmer House & Tower, Chicago, August 17-21, 1987 [1987]  
  Andersen, Marin Negative affectivity and accuracy in symptom reporting... 1995  
  Angel, Amanda Patricia Spanish women in the New World : the transmission of a model polity to New Spain, 1521-1570 1997  
  Anglade, Jean, 1915- Vie quotidienne des immigrés en France de 1919 à nos jours c1976 77477074//r90 2010020030
  Anselmi, Sheri M Mediating effects of acculturation and ethnic identity in adolescents' future narratives 1998  
  Anselone, Philip M Multivariable calculus with engineering and science applications 1996 95033009 0130452793
  Anti, Carlo, 1889-1961 Regio museo archeologico nel Palazzo reale di Venezia 1930 32023358  
  åOtomo, Katsuhiro, 1954- Akira. Book one c2000   1569714983
  Appleton, Nancy Healthy bones : what you should know about osteoporosis c1991 90020404 0895294621
  Apter, David Ernest, 1924- Pour l'Etat, contre l'Etat c1988   271781423X
  Archer, T[homas] A[ndrew] Crusades; the story of the Latin kingdom of Jerusalem 1900 04017421  
  Argentina. Ministerio de Educaciâon y Justicia Report upon the state of secondary and normal education in the Argentine Republic 1893  
  Argentina. Ministerio de Justicia e Instrucciâon Pâublica Antecedentes sobre enseänenza secundaria y normal en la Repâublica argentina .. 1903 07037172  
  Arnaiz, Alfredo R N-words and wh-in-situ : nature and interactions c1996  
  Asala, Joanne Celtic folklore cooking 1998 98003993 1567180442
  Atkinson, Kendall E Numerical solution of integral equations of the second kind 1997 96045961 0521583918
  Atlanta constitution (Atlanta, Ga. : 1897) Atlanta constitution 1897- sn 82015857  
  Aurore (Paris, France : 1897) Aurore [microform]   sn 93021477  
  Avellano, Gonzalo del Monografía económico-industrial sobre la industria cigarrera en la República Mexicana 1934?]  
  Bacho, Roderick Effects of acculturation, ethnic identity commitment, and family coping on Filipino-American family matrons' severity of psychological symptoms and attitudes towards mental health services 1997  
  Backman, Paul Variation in pathgenicity, morphology and RAPD... 1997  
  Baker, Jerry Jerry Baker's flowering garden c1989 89009948 0020303750
  Barlaz, Morton A Microbiological and chemical dynamics during refuse decomposition in a simulated sanitary landfill 1988  
  Barlow, David H Mastery of your anxiety and panic II c1994   1880659107
  Barney, Steve T Relationship between Christian religious beliefs, attributions, world views, and psychological symptoms in a population with a history of significant negative life events 1997  
  Bartleson, Janice A Diagnostic prognosticators among relationship partners of drug or alcohol-addicted persons 1991  
  Batin, Christopher Fishing Alaska on dollar$ a day : a comprehensive guide to fishing, hunting & outdoor recreation in Alaska's national forests 1992 91076370 0916771261
  Bauldock, Gerald Reaching for the moon c1988 88092848 0962172804
  Beard, George Miller, 1839-1883 Psychology of the Salem witchcraft excitement of 1692 [microform] : and its practical application to our own time 1882  
  Begoun, Paula Don't go shopping for hair care products without me : over 4,000 brand name products reviewed, plus the latest hair care information c2000   187798826X
  Begoun, Paula Don't go to the cosmetics counter without me : an eye-opening guide to brand-name cosmetics c1999 (1998 printing)  
  Bekoff, Marc Smile of a dolphin : remarkable accounts of animal emotions c 2000 2001271473 156331925X
  Bell, David, 1965- Introduction to cybercultures 2001 2001034971 041524658X
  Benedict, James B Analysis of reverse transfer students from Illinois State University 1987  
  Benjamin, Walter, 1892-1940 Iluminaciones, II: Baudelaire; un poeta en el esplendor del capitalismo [1972]  
  Benjamini, Eli Immunology : a short course c2000 00022485 0471348902
  Benn, I. M. (Ian M.) Introduction to spinors and geometry with applications in physics c1987 87021117 0852741693
  Bernabâe, Jean Eloge de la Crâeolitâe c1993   2070733238
  Berndt, Ernst R Practice of econometrics [computer file] c1991   0201514885
  Bernhard, Thomas Deutsche Mittagstisch : Dramolette 1988 88168876 3518114808
  Berns, Sandra Company law and corporate governance : an Australian perspective 1998   0195537955
  Best, Harold F. (Harold Francis), 1941- Analysis of factors associated with the academic success of academically dismissed reverse transfer students [microform] 1986  
  Best-Boss, Angie Living with P.C.O.S. : polycystic ovary syndrome c2001 00010670 1886039496
  Bi, Yafei Compact modeling of power bipolar transistor and parasitic bipolar transistor in LDMOS structures 1998  
  Bible. Hausa. 1979 Littafi mai tsarki : duk da Afokirifa (ko Deuterocanonical) c1979   0564011428
  Bickley, Ancella R History of the West Virginia State Teachers' Association c1979 79017268  
  Bingham, Caleb, 1757-1817 Columbian orator [microform] : containing a variety of original and selected pieces ; together with rules, calculated to improve youth and others in the ornamental and useful art of eloquence 1817  
  Bird, Helen P Relationship between co-dependence and borderline personality disorder [microform] 1996  
  Birth Defects Conference, San Francisco, 1978 Risk, communication, and decision making in genetic counseling [1979] 79005120 0845110306
  Bitsilli, P. M. (Petr Mikhailovich), 1879-1953 Izbrannoe 1993- 94165764//r97 9545091398
  Bivin, William Edward Nasal harmonies of twelve South American languages 1986  
  Blamey, Russell K. (Russell Keith) Profiles and motivations of nature-based tourists visiting Australia c1998   0642285063
  Blanc, Charles, 1813-1882 Grammaire des arts du dessin, architecture, sculpture, peinture .. 1867 10002269  
  Blathwayt, William, 1649?-1717 Blathwayt atlas; a collection of 48 manuscript and printed maps of the 17th century relating to the British overseas empire in that era, brought together about 1683 for the use of the Lords of Trade and Plantations [1970-75] 78654217 0870571257
  Bleyle, Karl, 1880-1969 Flagellantenzug: Tondichtung fèur grosses Orchester. Op. 9 c1908  
  Blog, Anne Elizabeth Perceived role changes in alcoholics and the significant others of alcoholics [microform] c1993  
  Blokhinëtìsev, D. I. (Dmitriæi Ivanovich), 1908- Philosophy of quantum mechanics [1968] 68101510  
  Blumberg, Ernest Richard, 1954- Consumer directed support for individuals with developmental disabilities: perspectives of family members and support providers 1998  
  Boedigheimer, Ralph Alan Customer-driven reliability models for multistate coherent systems 1992  
  Bohr, Niels Henrik David, 1885-1962 Causality and complementarity : supplementary papers c1998 98012467 1881987140
  Bombaci, Nancy Margaret Freaks and desire : fetishizing bodily difference in late modernist American culture 2000  
  Bond, James T 1997 National study of the changing workforce c1998   1888324090
  Boone, Louis E Contemporary business 2000 c2000 99074473 0030262569
  Boston daily globe (Boston, Mass. : 1872) Boston daily globe   sn 83045484#  
  Bothma, J. du P Carnivore ecology in arid lands c1998 97037163 3540592652
  Brahms, Johannes, 1833-1897 Trio : fèur Klavier, Violine und Waldhorn (oder Violoncello oder Viola) ; Opus 40 ; Es-dur [19--]  
  Brahms, Johannes, 1833-1897 Trio : op. 40    
  Braibant, Charles, b. 1889 Secret d'Anatole France [c1935]  
  Bratteli, Ola Operator algebras and quantum statistical mechanics c1987-c1997 86027877 0387170936
  Bremond, Henri Literary History of Religious Thought in France    
  Brigham, Albert Perry, 1855-1932 Our continental neighbors c1933 33014665  
  Brinig, Myron, 1897-1991 Flutter of an eyelid [c1933] 33025193  
  British School at Rome Catalogue of the ancient sculptures preserved in the municipal collections of Rome .. 1912- 14004918  
  British social attitudes (Codebook) British social attitudes ... survey   sn 98030219  
  Brodo, Irwin M Lichens of North America c2001 00049541 0300082495
  Bronson, Gary J Program development and design using C++ c2000 99056075 0534371302
  Brown, Heather E Sojourner adjustment among undergraduate students : relationships with locus of control and coping strategies 1998  
  Bruce, Robert Gray, 1968- "That's not funny, thats sick" : a bitter sweet taste of American black humor 1997  
  Bruice, Paula Yurkanis, 1941- Organic chemistry c2001 00044108 0130178586
  Bruice, Paula Yurkanis, 1941- Organic chemistry c2001 00044108 0130178586
  Bruice, Paula Yurkanis, 1941- Organic chemistry : study guide and solutions manual c1998  
  Brumana, Herminia C Tizas de colores 1932 33035983  
  Buisson La politique radicale    
  Buisson, F. E. (Ferdinand Edouard), 1841-1932 Politique radicale [microform], âetude sur les doctrines du parti radical et radicalsocialiste 1908  
  Burch, Noel Tragaluz del infinito : contribuciâon a la geneaologâia [sic] del lenguaje cinematogrâafico c1995   843760642X
  Burgess, Isaac B. (Isaac Bronson) Drill vocabulary for Virgil [1901] 01020397  
  Burgess, Isaac B. (Isaac Bronson) Drill vocabulary for Virgil 1888 30018110  
  Burgos, Julia de, 1914- Julia de Burgos : amor y soledad 1994 94206123 8478391363
  Burke, Ed, 1949- Serious cycling c2002 2001039843 073604129X
  Burton, Byrd, 1904- Study of opinions of college freshman women about home economics and related professional fields    
  Byer, John Luther Effects of students' perceptions of classroom social climate in middle school social studies classes on academic self-concept 1999  
  Cahill, Marie Patrick Joseph Changing patterns in the National Education Association from conservative professionalism to active unionism 1970  
  Calderío, Francisco 15 de marzo; análisis y perspectivas. [Microform] 1942  
  Cameron, Kenneth Walter, 1908- Whitman, Bryant, Melville, and Holmes among their contemporaries : a harvest of estimates, insights, and anecdotes from the Victorian literary world and an index c1976 76359751//r91  
  Camp, Caroline Eastburn, 1961- Publications of Marcel Moyse : an annotated survey with biographical contexts and pedagogical commentary 1997  
  Campbell, G. A. (George Archibald), 1900- Crusades 1938 39003529  
  Campbell, Toni Children's understanding of television commercials containing misleading nutritional information 1979  
  Campbell, Toni Format cues and content difficulty as determinants of children's cognitive processing of televised educational messages 1983  
  Cardoso, Oscar R. (Oscar Raúl) Malvinas, la trama secreta 1983 84118036 950370006X
  Caribe (Santo Domingo, Dominican Republic) Caribe [microform] [1948- sn 95026791#  
  Carr, John Dickson, 1906-1977 Black spectacles 1942  
  Carrano, Frank M Data abstraction and problem solving with C++ : walls and mirrors c1998 97030265 0201874024
  Carrera, Jesus Inverse modeling of Chalk River block : HYDROCOIN, level 2/case 3, level 3/case 5a 1988  
  Casadesus, Gaby Ma technique quotidienne = My daily technique : une approche de quelques difficultés pianistiques de la musique française = an approach to some of the difficulties in the piano technique of French music c1992 94702577  
  Casey, Kenneth Lyman, 1961- Count/mass syntax and superordinate categories : evidence of a conceptual distinction and its cognitive implications    
  Champion, Dean J Research methods for criminal justice and criminology 2000 99053409 0130139041
  Champion, Dean J Research methods for criminal justice and criminology 2000 99053409 0130139041
  Charmont, J. (Joseph), 1859-1922 Transformations du droit civil 1912 12017502  
  Cheney, Douglas Alan, 1949- Influence of the family, peer and school bond on school success and troubles : an analysis of seventh and eight grade students social and academic performance using a structural equation model 1992  
  Cheng, Chih-Liang Performance of Handel's solo violin sonatas : with a realization of the ornaments and an evaluation of the authenticity 1997  
  Cheng, Chin-chuan Mandarin phonology 1968  
  Chesley, Jill Louise Effects of normalized occupation on the lives of adults with mental retardation ... 1993  
  Chesner, Craig Alan Toba Tuffs and Caldera Complex, Sumatra, Indonesia : insights into magma bodies and eruptions 1988  
  Chessman, Harriet Scott Talk and silence in the novels of Virginia Woolf... 1979  
  Chew, Elizabeth V., 1963- Female art patronage and collecting in seventeenth-century Britain 2000  
  Chicago daily news (Chicago, Ill. : 1872) Chicago daily news 1872 sn 84024077  
  Cho, Sungeun Three Forms of Case Agreement in Korean 2000  
  Chong, Joong Ho Song of Moses (Deuteronomy 32:1-43) and the Hoshea-Pekah conflict [microform] 1990  
  Christiansen, Reidar Thoralf, 1886- Migratory legends 1977, c1958 77070585 0405100876
  Christopher Molyneux An Investigation into the Determinants Influencing the Decision Regarding the Method of Disposition of the Dead Within the Cape Town Area February 1985  
  Cimarosa, Domenico, 1749-1801 Concerto for oboe and strings [c1942]  
  Clark, Lynn, 1938- SOS help for parents : a practical guide for handling common everyday behavior problems c1996   0935111204
  Clark, Thomas Dionysius, 1903- History of Kentucky 1937 37016054  
  Clendinning, Jane Piper Contrapuntal techniques in the music of Gyèorgy Ligeti 1989  
  Cody, Ronald P Applied statistics and the SAS programming language c1997 97001737 0137436424
  Coffignon, A., 1861- Corruption áa Paris: le demi-monde, les souteneurs, la police des moeurs, brasseries de femmes, filles galantes, Saint-Lazare, le chantage, etc., etc [1888]  
  Cohen, Cafi And what about college? : how homeschooling leads to admission to the best colleges and universities c1997 97160795 0913677116
  Colloque international de littâerature: voies/voix ocâeaniques (1998 : Universitâe libre de Bruxelles) Lusophonie : voies/voix ocâeanique : Colloque international de littâerature, Universitâe libre de Bruxelles, 16-19 septembre 1998 [2000]   9727571336
  Colloquio sul tema: Goldoni in Francia, Rome, 1970 Atti del Colloquio sul tema Goldoni in Francia (Roma, 29-30 maggio 1970) 1972 76512668  
  Coloquio Internacional "Literatura y Espacio Urbano" (1st : 1993 : Alicante, Spain) Actas del I Coloquio Internacional "Literatura y Espacio Urbano" c1994 95110898 //r962 8475991556
  Communication reports (Pullman, Wash.) Communication reports c1988- sn 87004215  
  Congráes des Recherches Psychiques (1st : 1921 : Copenhagen) Compte rendu, officiel du Premier Congráes International des Recherches Psychiques áa Copenhague, 26 Aout - 2 Septembre 1921 1922  
  Congress of Industrial Organizations (U.S.). Constitutional Convention Proceedings of the ... Constitutional Convention of the Congress of Industrial Organizations 1948-1955 sn 85021260  
  Conner, Howard M Spearhead; the World War II history of the 5th Marine Division [1950] 50013407  
  Connolly, Marguerite A Transformation of home sewing and the sewing machine in America, 1850-1929 [microform] 1994  
  Connolly, Peter, 1935- Hannibal and the enemies of Rome 1978 79065844 0356059057
  Conrad, Walter, 1888- âEtude systâematique du genre Lepocinclis Perty 1935 ac 37000080  
  Conrad-Martius, Hedwig, 1888- Naturwissenschaftlich-metaphysische Perspektiven : drei Vorträge c1948  
  Consejo Nacional de Mujeres de la Repâublica Argentina Revista del Consejo Nacional de Mujeres de la Repâublica Argentina [microform] 1901- sf 94093098  
  Convegno di Studi per il VII centenario della conversione della Beata Angela da Foligno (1285-1985) (11-14 decembre 1985 : Foligno) Vita e spiritualitáa dell a Beata Angela da Foligno    
  Cook, Kathleen Roberta Paris conservatory and the Solos de concours for flute 1900-1955 c1991  
  Cook, Kathleen Roberta Paris conservatory and the Solos de concours for flute 1900-1955 c1991  
  Corcoran, John, 1948- Martial arts, traditions, history, people c1983 82011940 0831758058
  Corday, Pauline J'ai vécu dans Paris ocupé [1943] a 44000884  
  Corrigan, Timothy Short guide to writing about film c2001 00056752 0321081145
  Cosco, Joseph P., 1949- Eying Italians : race, romance, and reality in American perception, 1880-1910 1999  
  Croley, Laura Sagolla Wanderers and settlers: vagrancy, begging and the English middle class, 1790-1867 1996  
  Cromwell, Paul F Community-based corrections c2002 2001026062 0534559662
  Cross, K. Patricia (Kathryn Patricia), 1926- Feedback in the classroom : making assessment matter 1988  
  Crothers, Linda J., 1962- Affiliation to the Twelve-Step philosophy of Alcoholics Anonymous and its impact on substance abuse treatment 1999  
  Cuba. Ministerio de gobernación Líneas básicas del programa del plan trienal [microform] [1937?]  
  Cvijiâc, Jovan, 1865-1927 Questions balkaniques [1917?- 17028779  
  Dâavila, Marâia de Lourdes Desembarcos en el papel : la imagen la literatura de Julio Cortâazar 2001   9508450975
  Dada to kåosei shugi ten. English Dada and constructivism 1988  
  Dahlgren, Rolf, 1932- Revision of the genus Aspalathus [1960- 62002183  
  Daily graphic (New York, N.Y.) Daily graphic : an illustrated evening newspaper 1873-1889 sn 83045184  
  Dalili, Efia Nomalanga More than a sisterhood: traditional West African dance... 1999  
  Damodara, 17th cent [Sangitadarpana. The mirror of music and dance] Bydrage tot de kennis der voor-Indische muziek .. 1930  
  Danan, Yves Maxime Vie politique à Alger de 1940 à 1944 1963 63054844  
  Daniels, Harold Griffith, 1874-1952 Framework of France 1937 38007204  
  Danneberger, Tom Karl Epidemiology and control of anthracnose incited by Colletotrichum graminicola (Ces.) wils. on annual bluegrass [microform] 1983  
  Danticat, Edwidge, 1969- Farming of bones 1999 98042680 0786217324
  Darcan, Simon Cinâe audience : l'analyse de la dâecennie en 1033 films, le bilan de l'annâee 1981, suivi d'une grille prâevisionnelle des entrâees : une âetude de Simon Darcan ; prâefacâee par Jack Gajos 1982   2904015000
  Datnow, Amanda Educational reform implementation [microform] : a co-constructed process 1998  
  Daugherty, Paul L Effects of three exercise intensities on the alpha brain wave activity of adult males 1986  
  Davis, Ella M. (Ella Michelle) Investigation of self-efficacy and achievement facillitation for undergraduate students 1999  
  Davis, Jennifer S. (Jennifer Sandra) Law breaking and law enforcement : the creation of a criminal class in mid-Victorian London 1984  
  Davis, Lisa E Under the mink : a novel 2001 00053595 1555835562
  Dawnay, Jean Model girl 1956  
  Delaney, Melissa Ann Reverse registrants in community colleges 1995  
  Deleuze, Gilles Imagen-tiempo : estudios sobre cine 2 1987   8475094147
  Delpech, Auguste, b. 1846 Syllabus, l'Encyclique et la Dâeclaration des droits de l'homme [microform] 1901  
  Demmer, Maria Josefien Indigenous people conserving the rain forest? : the effect of wealth and markets on the economic behaviour of Tawahka Amerindians in Honduras 2001   9051130538
  Dennis, Marguerite J., 1946- Complete college financing guide c1997 94013195 0812095235
  Dent, Lester, 1904-1959 Hades & Hocus pocus 1979   0934498008
  Devlin, Athena Beth Between profits and primitivism: reabilitating white middle-calss mandhood in America, 1880-1917 2001  
  Dietrich, T. Stanton Urbanization of Florida's population : an historical perspective of county growth, 1830-1970 1978 84621766  
  Dimitri, Carolyn Organic food markets in transition [2000]   1893182215
  Doljanac, Robert Frank Using motivational factors and learning strategies to predict academic success 1994  
  Donnelly, Linda Sue Comparative cellular ultrastructure and chemical characterization of envelopes of three species of Trachelomonas (Euglenophyta) 1979  
  Dorcey, Mary, 1950- River that carries me 1995 95229081 1897648626
  Doyle, P British Toarcian (lower Jurassic) belemnites c1990-  
  Doyle, P British Toarcian (lower Jurassic) belemnites. Part 2 c1990  
  Drapkin, Israel, 1905- Cesare Lombroso : el creador de la moderna criminología científica 1977 92105831  
  Dreher, Nan H Public Parks in Urban Britain... 1993  
  Dubofsky, Melvyn, 1934- Labor in America : a history c1999 99017713 0882959794
  Ducrey, Pierre Warfare in ancient Greece 1986, c1985 86006704 0805239596
  Duffy, Karen, 1961- Model patient : my life as an incurable wise-ass c2000 00060264 0060197250
  Duhl, Lisa S Rocking an empty cradle : a psychological study of Yiddish Holocaust lullabies 1999  
  Dullea, Mark Marine biopolymers [1994] 96125163 1569650268
  Dunning, John Stewart, 1906- South American birds : a photographic aid to identification c1987 88006299 0915180251
  Dutton, Yasin Origins of Islamic law : the Qur®an, the Muwaòtòta® and Madinan °Amal 1999 99229764 0700710620
  Dziubinskyj, Aaron Aesthetic consciousness in the philosophical and literary texts of Josâe Vasconcelos 2001  
  Eddins, Don AEA : head of the class in Alabama politics : a history of the Alabama Education Association c1997 98070314  
  Edler De Roover, Florence, 1900-1987 Arte della seta a Firenze nei secoli 14. e 15. 1999   8822246950
  Einstein, Albert, 1879-1955 Entwurf einer verallgemeinerten relativitätstheorie und einer theorie der gravitation [microform]. I. Physikalischer teil von Albert Einstein.. 1913  
  Ejlersen, Mette I accuse 1969  
  El Paso times (1881) El Paso times [microform]    
  Elklit, Ask Aftermath of an industrial disaster [1997]   8716156137
  Emery, Carla Encyclopedia of country living : an old fashioned recipe book c1994 94000910 0912365951
  Enig, Mary G Know your fats : the complete primer for understanding the nutrition of fats, oils and cholesterol 2000 2001273748 0967812607
  Epstein, Benita L., 1950- Interlibrary loan sharks and seedy roms : cartoons from libraryland c1998 97040645 0786404655
  éSkaljiâc, Abdulah Turcizmi u srpskohrvatskom jeziku 1979  
  Ethnikåe Statistikåe Hypåeresia tåes Hellados Apotelesmata apographåes geåorgias kai ktåenotrophias tåes 14åes martiou 1971 : stoicheia apo katholikåe epexergasia tåon eråotåematologiåon kata dåemo åe koinotåeta apographåes tou archåegou tåon ekmetalleuseåon [1978?]-  
  Etienne, David Eugene Comparison and application of select teaching methods for the flute by Henri Altáes, Paul Taffanel-Philippe Gaubert, Marcel Moyse, and Trevor Wye 1988  
  Evans, Alvis J Making sense of sound : the basics of audio electronics and technology c1992   0790610264
  Evers, Gerd, 1942- Traunstein, 1918-1945 : ein Beitrag zur politischen Geschichte der Stadt und des Landkreises Traunstein c1991   3927909076
  Excélsior (Mexico City, Mexico) Excélsior [microform]    
  éZiézek, Slavoj Spectre is still roaming around : an introduction to the 150th anniversary edition of the communist manifesto 1998   9536542080
  Fabre, Daniel Carnaval ou la fãete áa l'envers D.L. 1992   2070531635
  Fallon, Sally Nourishing traditions : the cookbook that challenges politically correct nutrition and the diet dictocrats c1995 97143385 1887314156
  Fan, H. M Effective slab width of simple span steel I-beam composite bridges at ultimate load : interim report no. AW-120-3 1976  
  Farley, Alan S Master swing trader : tools and techniques to profit from outstanding short-term trading opportunities c2001 00062222 0071363092
  Fehr, Barbara Yankee denim dandies c1974 74079127 //r75 0878320148
  Fein, Steven Readings in social psychology : the art and science of research c1996 00265219 0395770602
  Fekkes, John III Isaiah and prophetic traditions in the Book of Revelation... 1988  
  Fenollosa, Ernest Francisco, 1853-1908 Outline of the history of Ukiyo-ye : illustrated with twenty reproductions in Japanese wood engravings 1901 03003116  
  Ferrell, Lori Anne Sermons at the Jacobean Court, 1603-1625    
  Ferrol, Manuel Emigracion : 1956 c1986   8439864930
  Fiera, Battista, 1469-1538 Ivsticia pingenda. On the painting of justice; a dialogue between Mantegna and Momus. The Latin text of 1515 reprinted with a translation, an introduction and notes 1957  
  Fisher, Donald C Baldrige on campus : the assessment workbook for higher education c1995 95017317 0527762989
  Flach, Patricia B Qualitative investigation of teaching for success : educating children with special needs in general education, elementary classroom environments c2000  
  Flament, Ivon Coffee flavor chemistry c2002 2001024880 0471720380
  Flament, Ivon Coffee flavor chemistry c2002 2001024880 0471720380
  Fletcher, Joyce K Toward a theory of relational practice in organization : a feminist reconstruction of "real" work 1994  
  Flora, Thomas George Attitude toward parents as a dimension of reverse transfer 1975  
  Foley, Mick Mankind, have a nice day! : a tale of blood and sweatsocks c1999 99056262 0060392991
  Fonsegrive, George, 1852-1917 Morale et sociâetâe 1907  
  Foote, Mary Hallock, 1847-1938 Victorian gentlewoman in the Far West; the reminiscences of Mary Hallock Foote 1972 7286535//r922  
  Ford, Mary Towards the restoration of allegory : christology, epistemology and narrative 1990  
  Ford, Michael Thomas Little book of neuroses : ongoing trials from my queer life 2001 2001046074 1555836437
  Forman, Henry Chandlee, 1904- Turner family of Hebron and Betterton, Maryland [microform] 1933 85129484  
  Foster-Powell, Kaye Glucose revolution pocket guide to your heart c2000 00021901 1569246408
  Foucault, Michel History of sexuality 1990-   0679724699
  Fournier, Christiane Bâebâe colonial : une enfance au Tonkin 1935  
  Fox, Robert W., 1934- Introduction to fluid mechanics [1998?] 99160483 0471124648
  Francis, Martha Elizabeth Analysis of the language and process dimensions found in personal disclosure : the LIWC approach 1993  
  Fraser, Margaret R Critical program components for preparing teachers to educate diverse learners : a national perspective 1998  
  Frenkel, Jean Géométrie pour l'élève-professeur [1973] 74161329 2705613625
  Fries, Elizabeth Overconfidence in health knowledge and predictions of personal health behaviors 1992  
  Frisse, Linda M., 1969- Understanding the mechanisms of microsatellite formation and mutation using the model organism Caenorhabditis elegans [microform] 1999  
  Fritch, John E Role of evidence in historical narratives : the case of Christopher Columbus 1994  
  Frontiers (Boston, Mass.) Frontiers : the interdisciplinary journal of study abroad c1995- 96650427  
  Fu, Haizhen Exploring component commonality issues in a supply chain 1998  
  Fujita Rony, Dorothy Bintang "You got to move like hell" : trans-Pacific colonialism and Filipina/o Seattle, 1919-1941 1996  
  Gackle, Martha Lynne Effect of selected vocal techniques for breath management, resonation, and vowel unification on tone production in the junior high school female voice 1987  
  Gallagher, Janet M Telling stories about God : narrative voice and epistemology in the Hebrew Bible and in the fiction of Flannery O'Connor, Graham Greene and Cynthia Ozick 1990  
  Gambia Constitution of the Republic of the Gambia, 1997 [1997]   9983860112
  Garcâia, Nora Lee, 1969- Bernard Goldberg : a biographical sketch and study of his teaching technique : a doctoral essay c1999  
  Gat, Irit Incarcerated mothers : effects of the mother/offspring life development program (MOLD) on recidivism, pro social moral development, empathy, hope, and parent-child attachment 2000  
  Gaudon, Jean, ed Ce que disent les tables parlantes [1964, c1963]  
  Gauthier, Robert Édouard, 1901- ed Dreyfusards! 1965 67073212  
  Gelb, Michael How to think like Leonardo Da Vinci : seven steps to genius every day c1998 98004655 0385323816
  Gelman, Juan, 1930- Hacia el sur 1982   9684810083
  Gettman, Dennis Jerald Investigation of the shared mental model construct in the context of a complex team task 2001  
  Gilbert, Adrian Going to war in Ancient Greece 2001 00043545 0531145905
  Gillespie, Aline Widening horizons : the YWCA in Queensland 1888-1988 1995   0949525235
  Gingerich, Carol Joy French piano style of Fauré and Debussy [microform] : cultural aesthetics, performance style characteristics, and pedagogical implications 1996 cn 97200316  
  Gingerich, Karen E Impact of study abroad and didactic cross-cultural coursework experiences on the development of White racial consciousness and cultural sensitivity 1998  
  Girgis-Hanna, Mary F Aging with mental retardation : a growing concern 1997  
  Gleason, Patrick J., ed Environments of south Florida: past and present 1974  
  Glos, P Reliability theory for timber structures: determination of compression ...    
  Glymour, Bruce Model of causal, statistical explanation in evolutionary biology 1995  
  Goedde, Petra, 1964- GIs and Germans : culture, gender, and foreign relations, 1945-1949    
  Gofbarg, Gadi Strategies of Hans Haacke 1990  
  Gooch, Bryan N. S Musical settings of late Victorian and modern British literature : a catalogue 1976 75024085 0824099818
  Goodrich, Michael T Data structures and algorithms in Java c2001 00043294 0471383678
  Gray, Asa, 1810-1888 Scientific papers of Asa Gray 1889 05036438  
  Greco, Emanuele Poseidonia - Paestum 1980-   2728305773
  Green, Wayne H Child and adolescent clinical psychopharmacology c2001 2001016453 0781724716
  Greenfield, Stanley B., ed Studies in Old English literature in honor of Arthur G. Brodeur 1963 63024538  
  Greenough, J. B. (James Bradstreet), 1833-1901 Special vocabulary to Virgil : covering his complete works 1882, t. p. 1895  
  Grierson, Cecilia, 1859-1934 Educacion tâecnica de la mujer : informe presentado al Sr. Ministro de Instrucciâon Pâublica de la Repâublica Argentina 1902  
  Groslier, George, 1887- Donneurs de sang, roman 1942  
  Groves, William McDonald Commedia dell'Arte and the Shakespearean theatre : a study of the relevance of applying Commedia dell'Arte techniques to Shakespearean production 1983  
  Gueullette, Charles, 1834-1892 Peintres espagnols; études biographiques et critiques sur les principaux maitres anciens et modernes 1863  
  Gurney, Ivor, 1890-1937 Western playland (and of sorrow), song-cycle for baritone voice, string quartet and pianoforte 1926  
  Gushchina, K. A Gosudarstvennyi arkhiv Ivanovskoi oblasti : putevoditel' 1962 95193097  
  Gussow, Joan Dye This organic life : confessions of a suburban homesteader c2001 00052313 1890132942
  Haag,Marcia Lynn Lexical Categories in Choctaw and universal grammar 1997  
  Hall, Adelaide Susan, 1857- Two travelers in Europe : a unique story told by one of them : what they saw and how they lived while traveling among the half-civilized people of Morocco, the peasants of Italy and France, as well as the educated classes of Spain, Greece, and other [c1913] 13009445  
  Hall, Jason Yarwood Lineaments of character [Mikrofiche] : physiognomy from Lavater to Lombroso 1979  
  Hamilton, Cicely Mary, 1875- Diana of Dobson's : a romantic comedy in four acts c1925  
  Hannon, Bill Agents in my brain : how I survived manic depression c1997 97002782 0812693469
  Harrison, Lou, 1917- Music primer; various items about music to 1970 c1971] 73152541  
  Hart, Kitty Return to Auschwitz : the remarkable story of a girl who survived the Holocaust 1985, c1981   0689706375
  Harter, Susan, 1939- Manual for the self-perception profile for adolescents 1988  
  Hartnett, Stephen, 1963- Cultural fictions : the critical theory of historiography, the political-economy of modernity, and the paradoxes of Whitman's America 1992  
  Harvey, Carol P Understanding and managing diversity : readings, cases, and exercises c2002 2001036163 0130292648
  Haydn, Joseph, 1732-1809 Konzert D-dur : opus 101 für Violoncello und Orchester [19--]  
  Haydn, Joseph, 1732-1809 Konzert, D dur. Fèur Violoncell mit Orchester [189-]  
  Haynes, Renâee, 1906- Society for Psychical Research, 1882-1982 : a history 1982 82240579 0356078752
  Healey, Jane Frances Annotated bibliography of privately published autobiographies gathered by the Baylor University Texas Collection 1986  
  Heath, Deborah, 1952- Politics of signifying practice in Kaolack, Senegal : hegemony and the dialectic of autonomy and domination c1988  
  Heaton, Robert K Comprehensive norms for an expanded Halstead-Reitan battery: demographic corrections, research findings, and clinical applications c1991 91228778  
  Helbig, Gerhard Deutsche Partikeln--richtig gebraucht? 1995   3324006082
  Hemenway, Toby, 1952- Gaia's garden : a guide to home-scale permaculture c2001 2001017353 1890132527
  Hendricks, Cheryl Margaret "We knew our place" : a study of the constructions of colouredidentity in South Africa 2000  
  Hendricks, Reneâe Christine Examination of the teaching methods of seven nineteenth century piano pedagogues 1988  
  Hendricks, Reneâe Christine, 1962- Examination of the teaching methods of seven nineteenth century piano pedagogues [microform] 1988  
  Hendrix, Harville Personal companion : meditations and exercises for keeping the love you find c1995 95071578 0671868845
  Hèohn, Maria GIs, Veronikas and Lucky Strikes : German reactions to the American presence in the Rhineland-Palatinate during the 1950's 1995  
  Hernaâandez, Ana Marâia Mujer mexicana en la industria textil 1940 43045631  
  Hernaâandez, Ana Marâia Mujer mexicana en la industria textil 1940 43045631  
  Hewatt, Vivian Elizabeth History of education in Argentina through Sarmiento's administration 1942  
  Hewitt, John S., 1948- Optimal foraging models for the lower Illinois River Valley 1983  
  Hifi, Belkacem Immigration algâerienne en France : origines et perspectives de non-retour c1985 85221753  
  Hillard, A. E. (Albert Ernest), 1865-1935 Elementary Latin translation 1989   0715623184
  Hindley, J. Roger Basic simple type theory 1997 95009058 0521465184
  Hinton, Raymond William King Eastland trade and the common weal in the seventeenth century 1959 59016034  
  Hiscox, Arthur R Oliver Cromwell's Western Design: a study in the survival of Elizabethan strategy 1973  
  Historic American Buildings Survey New York city architecture 1969 73604028  
  Hogan, Thaddeus, 1842- Sermons, doctrinal and moral 1915  
  Holloway, Ralph Selah Sociological theory and analysis of the self: a study of self attitudes as related to the selection of social roles 1953  
  Holmes, Michael Blaine Grain-oriented ferroelectric ceramics    
  Holroyd, Jean Questionnaire on resources and stress : for families with chronically ill or handicapped members c1987 92235828 0884220974
  Horvath, Brandon Joseph Comparison of Colletotrichum spp. causing crown rotting anthracnose to Colletotrichum graminicola and Colletotrichum sublineolum isolates using isozyme markers 1999  
  Howard, Albert, Sir, 1873-1947 War in the soil [1946] 54027114  
  Howard, Robert Ervin, 1906-1936 Mayhem on Bear Creek 1979 97144766  
  Howell, Wayne Keeney, 1925- Some inter-relationships of expressed ethnic attitudes and brief inter-cultural contacts : an investigation based on the written responses of educational tour members, traveling under the direction of the Travel Division of the National Education Ass 1962  
  Hsien, Hsing-hai, 1905-1945 Yellow River concerto c1973  
  Hubbard, Edward E Measuring diversity results c1997   1883733170
  Hubbard, Phil Sex and the city : geographies of prostitution in the urban West c1999 99076363 0754610799
  Huebner, Steven Second empire operas of Charles Gounod [microform] 1985 cn 86023360  
  Hughes, Howard Raymond History of Delanco Camp Meeting Association 1961  
  Hughes, William Martin Trombone in performance of the bass-solo canzonas of Girolamo Frescobaldi 1988  
  Hugo, Charles Victor, 1826-1871 Homes de Lâexil : prâecâedâesde "mes fils" Victor Hugo 1875  
  Hultberg, Teddy Öyvind Fahlström i etern : manipulera världen : Fåglar i Sverige, Den helige Torsten Nilsson, bilder & manuskript = Öyvind Fahlström on the air : manipulating the world : Birds in Sweden, The Holy Torsten Nilsson, pictures & manuscripts / Teddy Hultb c1999 00330498 9152218171
  Hummel, Michael D Attitudes of Edward Bok and the Ladies' home journal toward woman's role in society, 1889-1919 1982  
  Hutchinson, Lucy Apsley, b. 1620 On the principles of the Christian religion, addressed to her daughter ; and on theology 1817  
  Imbruno, Kathleen Poesâia feminista puertorriqueäna : de la toma de conciencia a la toma de la palabra 1986, c1987  
  Impey, Chris Universe revealed c2000 99028561 0534248942
  Inness, Sherrie A Dinner roles : American women and culinary culture c2001 00053637 087745762X
  International Alliance of Women Woman suffrage in practice, 1913 [1913?]  
  International Conference of the Cape American Studies Association (2nd : 1998 : University of Cape Town) Juxtapositions : the Harlem Renaissance and the lost generation : proceedings of the second International Conference of the Cape American Studies Association held at the University of Cape Town 2000  
  International Conference on Conceptions of Library and Information Science (2nd : 1996 : Copenhagen, Denmark) Proceedings : integration in perspective, October 13-16, 1996 1996 97168707 8774152602
  International Conference on Silicon Carbide and Related Materials Silicon carbide and related materials, 1995 : proceedings of the Sixth International Conference, Kyoto, Japan, 18-21 September 1995 c1996 gb 96048417 0750303352
  International Conference on the Guodian Laozi (1998 : Dartmouth College) Guodian Laozi : proceedings of the international conference, Dartmouth College, May 1998 2000 00021567 1557290695
  International congress of anthropology. (1893: Chicago) Memoirs of the International congress of anthropology 1894 04027528  
  International Congress on Engineering and Food (7th : 1997 : Cologne, Germany) Engineering & food at ICEF 7 c1997   185075814X
  International Marine Biological Workshop (3rd : 1988 : Albany, W.A.) Marine flora and fauna of Albany, Western Australia : proceedings of the Third International Marine Biological Workshop c1990-c1991 92150327 0730939537
  International Ornithological Congress (11th : 1954 : Basel) Acta XI Congressus Internationalis Ornithologici, Basel 29. V.-5. VI. 1954 1955 a 56005456  
  International Symposium on Advances in Baking Science and Technology (1984 : Kansas State University) International Symposium on Advances in Baking Science and Technology [1984]  
  International Symposium on Controlled Release of Bioactive Materials (17th : 1990 : Reno, Nev.) Proceedings : 17th International Symposium on Controlled Release of Bioactive Materials, July 22-25, 1990, Reno, Nevada, U.S.A. c1990  
  International Symposium on Fundamentals of Rock Joints (1985 : Bjèorkliden, Sweden) Fundamentals of rock joints : proceedings of the International Symposium on Fundamentals of Rock Joints, Bjèorkliden, 15-20 September 1985 1985   918699803X
  Isham-Colvard, Dolores Codependency : a meta-analysis of related variables ... c1998  
  Isseroff, Sampson A Introduction to Rashi's grammatical explanations in the book of Numbers = Sha°ar le-diòkduòke Rashi, Sefer Be-midbar Sinai 1992]  
  Ivy, A. C. (Andrew Conway), 1893- Peptic ulcer 1950 50004047  
  Jaccottet, Philippe Carnets : 1995-1998 (la Semaison, III) c2001   2070761932
  Jackson daily news (Jackson, Miss. : 1860) Jackson daily news 1860- sn 83016826  
  Jackson, Carlton J. I. Rodale: apostle of nonconformity 1974   0515034037
  Jackson, Chris J Designing and analysing questionaires and surveys : a manual for health professionals and administrators 2000   1861560729
  Jackson, Pamela Braboy Context of transition events across the life course : the effects of prior event sequencing on adult mental health 1993  
  Jackson, Tamara Roberta, 1956- Social support network of a sample of drug-abusing women and their prenatally drug-exposed children 2000  
  Jacobs, Joseph, 1854-1916, ed Celtic folk and fairy tales [n.d.]  
  Jaeger, Ellsworth Wildwood wisdom [1992] 92080291 0936070129
  Jelinek, Elfriede, 1946- Piano teacher 1989, c1988   1852421576
  Jensen, Carl G Cross-currents of influence in the backgrounds of twelve chosen American and Japanese potters : as related to the emergence of a new ceramic presence in the late fifties 1971  
  Jewell-Jackson, Deborah Moira Ending mandatory busing for desegregation in Norfolk, Virginia [microform] : a case study explaining the decision making process in a formerly de jure southern school district 1995  
  Jha, Mithilesh K Day to day travel choice dynamics in transportation networks... 1996  
  Jitrik, Noé, 1928- 80 [i.e. Ochenta] y su mundo; [presentación de una época [1968] 77250855  
  Joe, Harry Sue Wah Percentile residual life functions -- properties, testing and estimation 1982  
  Johnson, Cathy (Cathy A.) Sierra Club guide to painting in nature c1999 99014619 0871569345
  Johnson, Keith M., 1941- Classical horn concerto cadenza 1976  
  Johnson, Leslie Faye Shostakovich Viola Sonata: An analytical performer's guide 1991  
  Johnson, Theodore Wallace, 1928- Black images in American popular song, 1840-1910 c1975  
  Joint U.S. Geological Survey, U.S. Nuclear Regulatory Commission Workshop on Research Related to Low-level Radioactive Waste Disposal (1993 : Reston, Va.) Joint U.S. Geological Survey, U.S. Nuclear Regulatory Commission Workshop on Research Related to Low-level Radioactive Waste Disposal, May 4-6, 1993, National Center, Reston, Virginia : proceedings 1996 96215993  
  Jurafsky, Dan, 1962- Speech and language processing : an introduction to natural language processing, computational linguistics, and speech recognition 2000 99087845 0130950696
  Kabat-Zinn, Jon Wherever you go, there you are : mindfulness meditation in everyday life c1994   0786880708
  Kaduck, John M Advertising trade cards 1976   0870690809
  Kaentzler, Peter Stephan Vita Sancti Karoli Magni    
  Kafton, David Lewis Isozyme variability and reproductive phenology of Monterey cypress 1977  
  Kailin, Julie Engaging teachers in anti-racist pedagogy : an historical and ethnographic study c1996  
  Kanouse, David E Negativity in evaluations c1972  
  Kanter, Deborah Ellen Hijos del pueblo : family, community, and gender in rural Mexico, the Toluca region, 1730-1830 1993  
  Karlin, Samuel, 1923- First course in stochastic processes [1975] 74005705 0123985528
  Kauffmann, Norman L Impact of study abroad on personality change 1983  
  Keating, Christopher James Institutional constraints and Bolivian agrarian development during the pre-agrarian reform and post-agrarian reform periods 1998  
  Keen, W. C. (William Charles) Cacti and succulents : step-by-step to growing success 1990 92170370 1852232641
  Kennedy, David (David Daniel) Feng shui for dummies c2001 00109409 0764552953
  Kennedy-Moore, Eileen Expressing emotion : myths, realities, and therapeutic strategies c1999 99013223 1572304731
  Kenrick, Francis Patrick, 1796-1863 Primacy of the apostolic see vindicated [microform] 1855   079055237X
  Kerley, Donald Craig Effects of three aspects of social competence on academic performance : a structural equations model 1997  
  Kèupfmèuller, Karl, 1897- Einfèuhrung in die theoretische elektrotechnik 1932 32019252  
  Kim, Jason Hyungkyun Effects of assimilation within the Korean immigrant church [microform] : intergenerational conflicts between the first and the second generation Korean Christians in two Chicago suburban churches 1999  
  Kingsolver, Barbara Pigs in heaven : a novel 1999, c1993   006109868X
  Kinsley, William J Document photography : its use in court ca. 1910]  
  Kirby, James B Wellbeing of adolescents [microform] : do co-resident grandparents matter? 1999  
  Klose, Friedrich Das Leben ein Traum 1896  
  Koch, Todd The psychological effects of traumatic brain injury as measured by the Minnesota Multiphasic Personality Inventory 2 2001  
  Koltanowski, George, 1903- Colle system 1990   0931462983
  Koppich, Julia Studies of excellence in teacher education : preparation in a five-year program c2000 00364731 0965453553
  Kraevedcheskie zapiski (Ivanovo, Russia) Kraevedcheskie zapiski   sn 97032288  
  Kreiner, Robert Paul Status study of existing procedures for textbook selection in Ohio 1980  
  Kuczera, Aleksander Samborszczyzna 1935-1937  
  Kudrewicz, Jacek Czñestotliwoâsciowe metody w teorii nieliniowych uk±adâow dynamicznych 1970 70299100  
  Kuhrt, Amâelie, 1944- Ancient Near East, c. 3000-330 BC 1997   0415167620
  Kunzer, Paul E Vocabulary of Vergil's Aeneid [196-?]  
  Kurose, James F Computer networking : a top-down approach featuring the Internet c2001 00025295 0201477114
  Kutumba Rao, Kodavatiganti, 1907- Anubhavaòm.Koòdavatiganti Kuòtumbaråavu 1970] 72912059  
  LaFleur, Richard A "Latina resurgens : classical language enrollments in American schools and colleges" 1997?]  
  LaFleur, Richard A Love and transformation : an Ovid reader c1999 98218230 067358920X
  LaHaye, Tim F Apollyon : the Destroyer is unleashed c1999 98032064 0842329161
  LaHaye, Tim F Desecration : Antichrist takes the throne c2001 2001003115 084233226X
  LaHaye, Tim F Left behind : a novel of the earth's last days c1995 95019132 0842329110
  Lake, John G Adventures in God c1991   0892748192
  Lake, John Graham, 1870-1935 Spiritual hunger, the God-men : and other sermons 1976  
  Lamberton, Damien Introduction to stochastic calculus applied to finance 1996 96084905 0412718006
  Lankford, Thomas E Feeding and growth of juvenile weakfish (Cynoscion regalis) : influence of temperature, salinity and prey selectivity 1993  
  Laqueur, Walter, 1921- Was niemand wissen wollte : die Unterdrèuckung der Nachrichten èuber Hitlers "Endlèosung" c1981   3550079478
  Larson, Julia Ann Flute without accompaniment [microform] : works from Debussy : Syrinx (1913) to Varáese : Density 21.5 (1936) 1990  
  Larson, Patricia J., 1934- Oncology patients' and professional nurses' perceptions of important nurse caring behaviors 1981  
  Laubscher, Michael R Encounters with difference : student perceptions of the role of out-of-class experiences in education abroad 1994 93037505 0313289778
  Le, Tao Underground step 1 answers : to the NBME retired & self-test questions : preparation for the USMLE step 1 c1996 00500884  
  Lee, Jeong-Shik Case alternation in Korean : case minimality 1992  
  Lee, Samuel Mau-Cheng, 1948- Comparative study of leadership selection process among four Chinese leaders 1985  
  Lee, Sangho Social cognitive approach to leadership : application of self-efficacy theory to leadership at the dyad and group levels of analysis 1992  
  Leguizamâon, Onâesimo, 1840-1886 Instrucciâon pâublica en la Repâublica Argentina 1879  
  Lehninger, Albert L Lehninger principles of biochemistry c2000 99049137 1572591536
  Lemarchand, René Burundi : ethnic conflict and genocide 1996 96233050 0521566231
  Lerner, Elinor Immigrant and working class involvement in the New York City woman suffrage movement, 1905-1917 : a study in progressive ERA politics 1981  
  Leslie, Clare Walker Keeping a nature journal : discover a whole new way of seeing the world around you c2000 00030748 1580173063
  Leslie, Kent L On the interpretation of the horn part of the trio in E-flat major, opus 40, by Johannes Brahms 1983  
  Levine, David M., 1946- Applied statistics for engineers and scientists : using Microsoft Excel and MINITAB c2001 00039992 0134888014
  Levine, Peter A Waking the tiger : healing trauma : the innate capacity to transform overwhelming experiences c1997 97003918 155643233X
  Littell, Ramon C SAS System for linear models c1991 92221796 155544430X
  Liu, Jih-Shiou, 1960- Evolution of the fungal tribe Balansieae (Clavicipitaceae) and related endophytes of grasses 1993  
  Lleâo Caänal, Vicente Nueva Roma : mitologâia y humanismo en el renacimiento sevillano 1979 80126415 8450035104
  Lomborg, Bj²rn, 1965- Skeptical environmentalist : measuring the real state of the world c2001 00068915 0521804477
  Loos, Eugene E Verbos performativos : partâiculas que tienen signâificado performativo o significado relacionado a los performativos en idiomas panos 21 cm  
  Lowe, C Test methods for UV & EB curable systems 1997, c1996   0947798072
  Lu, Chi-Hsien Joseph Use of degredation measures in assessing reliability 1992  
  Luciw, Wasyl [Literaturna Boæikivshchyna ; antolohiëiìa 1969 72209437  
  Lutton, Joan Drody, 1942- Cushman School : the history of an independent school in Dade County, Florida 1982  
  Lynn, Carol, pseud Modeling for money; how to become a successful mannequin, with valuable hints to all women on how most effectively to wear their clothes [c1937] 37027249  
  Lypyns'kyæi, Vëiìacheslav, 1882-1931 Szlachta na Ukrainie 1900-  
  Maänach, Jorge, 1898-1961 Militarismo en Cuba; recopilaciâon de artâiculos publicados en el diario "Acciâon," de la Habana 1939 45051925  
  MacDonald, Ann-Marie, 1958- Fall on your knees : a novel 1997, c1996 96034186 0743237196
  MacDougall, Susan A Developmental style of Johannes Brahms, as seen in representative chamber works with piano 1980  
  Macgregor, Mary Story of Greece told to boys and girls [1914] 15013566  
  Maier, Nicholas W., 1968- Trading with the enemy : seduction and betrayal on Jim Cramer's Wall Street c2002 2001039929 0060086513
  Mandel, Mark Alan Phonotactics and morphophonology in American Sign Language 1981  
  Mann, Prem S Introductory statistics c2001   0471373532
  Manure Management in Harmony with the Environment and Society (1998 : Ames, Iowa) Manure management in harmony with the environment and society [1998]  
  Marcuse, Herbert, 1898- Ende der Utopie. Herbert Marcuse diskutiert mit Studenten und Professoren Westberlins an der Freien Univ. Berlin èuber die Mèoglichkeiten und Chancen einer politischen Opposition in den Metropolen in Zusammenhang mit den Befreiungsbewegungen in den L [1967] 73578999  
  Marquis, Alice Goldfarb Art biz : the covert world of collectors, dealers, auction houses, museums, and critics c1991 90024788 0809242834
  Marquis, Judith Las imagenes en los abecedarios espirituales 1970  
  Martins, Laura Maria Primer plano : genero, contemporaneidad y modernizacion : cine y literatura en Argentina (1955-1969) 1996  
  Maslach, Christina Maslach burnout inventory : manual c1986 89102570  
  Mass. Division of Forestry Laws relating to gypsy and brown-tail moths    
  Matsumoto, David Ricky Nihonjin no kanjåo sekai : misuteriasu na bunka no nazo o toku 1996 (1997 printing) 98456843 4414301467
  Matsumoto, Yåuko, 1963- Watashi ga suki Heisei 9 [1997]   4041859026
  Maxfield, Michael G Research methods for criminal justice and criminology c1998 97028501 0534521649
  McClellan, George Brinton, 1826-1885 George B. McClellan Sr. papers, 1823-1898 [microform] 1973  
  McClurg, Scott Douglas Socially transmitted politics : the role of interpersonal networks in encouraging political participation 2000  
  McCulloch, Charles E Generalized, linear, and mixed models 2001 00059430 047119364X
  McCulloch, Charles E Generalized, linear, and mixed models 2001 00059430 047119364X
  McCullough, Edo World's Fair midways; an affectionate account of American amusement areas from the Crystal Palace to the crystal ball [1966] 65028078  
  McCunn, Ruthanne Lum Thousand pieces of gold : a biographical novel 1988, c1981 88047881 0807083178
  McCurry, Don M Muslim awareness seminar c1981 81051942 0940484005
  McDaniel, Vernon History of the Teachers State Association of Texas c1977 76030446  
  McEnerney, Stuart James Predicting academic success for the reverse transfer student in the public two year community colleges in the state of Connecticut 1977  
  McGlone, Jennifer L. (Jennifer Link), 1965- Examination of the codependency construct : the effects of labeling 1993  
  McKean, Kathleen E., 1954- Statistical power analysis of doctoral dessertation research in educational psychology 1990  
  McKee, Nancy Utilization factors relating to adult day care 1994  
  McMillan, Vicky, 1947- Writing papers in the biological sciences c1997 95080799 0312115040
  McNeal, Mark Patrick The effects of grain and particle size on the microwave dielectric properties of ferroelectric barium titanate 1997  
  Mehlferber, Jon Paul, 1964- Dwelling as a sculptural motif : a critical analysis of selected contemporary works 1993  
  Mendelson, Elliott Introduction to mathematical logic 2001, c1997   0412808307
  Mercer, Linda P. (Linda Pushee), 1947- Reproductive biology and population dynamics of black sea bass, centropristis striata 1978  
  Mexico. Secretarâia de Hacienda y Crâedito Pâublico Estadâistica de la Repâublica Mexicana. Estado que guardan la gricultura, industria, minerâia y comercio. Resâumen y anâalisis de los informes rendidos âa la Secretarâa de hacienda por los agricultores, mineros, industriales y comerciantes de la repâ 1880 05022092  
  Meyer, Clarence Old ways rediscovered c1988 88009165 0916638189
  Meyer, Jason, 1950- Systematic desensitization versus relaxation training and no treatment (controls) for the reduction of nausea, vomiting and anxiety resulting from chemotherapy 1982  
  Mezhov, V. I. (Vladimir Izmailovich), 1831-1894 Trudy TSentral'nago i gubernskikh statisticheskikh komitetov 1873  
  Miller, Albert Basil Effective width of a plate supported by a beam." 1929 30008967  
  Miller, John David Henry Augustus Rowland and his electromagnetic researches 1970  
  Miller, Larry S Police photography c1998 98018745 087084816X
  Minten, Bart; Kyle, Steven The effect of distance and road quality on food prices... 1995  
  Mirabella-Beck, Jean Relationship between maternal history of victimization, current social supports, and abusive parenting behaviors : a Winnicottian perspective 1999  
  Moeran, E. J. (Ernest John), 1894-1950 Ludlow town : four poems from A Shropshire lad [19--?]  
  Moine, Claudine, b. 1618 Ma vie secrète .. 1968  
  Molnâar, Miklâos, 1918- Histoire de la Hongrie 1996   2743800763
  Monk, David H Educational finance : an economic approach c1990 88032242 0075572370
  Montgomery daily advertiser (Montgomery, Ala. : 1858) Montgomery daily advertiser   sn 84023549  
  Montgomery, L. M. (Lucy Maud), 1874-1942 Akage no an = Anne of Green Gables 1993   4087740072
  Montgomery, L. M. (Lucy Maud), 1874-1942 An no ai no katei Shåowa 40 [1965]  
  Montgomery, L. M. (Lucy Maud), 1874-1942 An no aijåo Shåowa 31 [1956] (1982 printing)   4102113037
  Moore, David S Introduction to the practice of statistics c1999 97045727 0716735024
  Moravia, Alberto, 1907- Agostino / Alberto Moravia 1981, c1945  
  Moray, T. Henry (Thomas Henry) Sea of energy = from the original The sea of energy in which the earth floats 1978 79107428  
  Morelle, Chantal Henri Laugier : un espirit sans frontières 1997   2802710559
  Moritz, Sandra Elaine Effect of task type on the relationship between efficacy beliefs and performance 1998  
  Morse, Sidney E. (Sidney Edwards), 1794-1871 Memorabilia in the life of Jedidiah Morse, D.D. : formerly pastor of the First Church in Charlestown, Mass. 1867  
  Mott, John Raleigh, 1865- Addresses and papers 1946-47 47002298  
  Mu~noz Rivera, Manuel, 1920- ?Hacia dónde héroes? La historica tragicomedia bélica en esta segunda guerra mundial, de los soldados puertorrique~nos pertenecientes al regimiento regular de Puerto Rico, 65 de infantería 1948  
  Munkres, James R., 1930- Topology c2000 99052942 0131816292
  Murray, Alison Joan Framing greater France : images of Africa in French documentary film, 1920-1940 1998  
  Murray, Robert (Robert P.), 1936- Evolution of interpretation as reflected in successive editions of J.S. Bach's Chaconne 1976  
  Myers, Jane, 1955- Shores of a dream : Yasuo Kuniyoshi's early work in America 1996 96031120 0883600862
  Myers, William Starr, 1877-1956 Study in personality, General George Brinton McClellan 1934 34033658  
  Mysevych, Ostap Ukraïns'bkyi vesil'nyi obriad u Boikivshchyni 1979 84208222  
  Nalty, Linda Pearson Social networks of women and men in residential treatment for chemical dependency 1997  
  Nashville Tennessean (Nashville, Tenn. : 1918) Nashville Tennessean 1918-1972 sn 84024774  
  National Academy of Sciences (U.S.) Proceedings 1877-95 15010605  
  National Structural Engineering Conference, University of Wisconsin--Madison, 1976 Methods of structural analysis : proceedings of the National Structural Engineering Conference, an ASCE Structural Division specialty conference at the University of Wisconsin, August 22-25, 1976, Madison, Wisconsin 1976 77359243  
  Nawrocki, S.P. Biomechanical model of cranial vault thickness... 1991  
  Nehrling, Henry, 1853-1929 My garden in Florida and miscellaneous horticultural notes [c1944-1946] agr44000205  
  Nelson, Michael J Mike Nelson's movie megacheese c2000 00712097 0380814676
  Nenninger, Timothy K Fort Leavenworth schools : post graduate military education and professionalization in the U.S. Army, 1880-1920 c1974  
  News & observer (Raleigh, N.C. : 1894) News & observer 1894-  
  Newton, Michael, 1931- Destiny of souls : new case studies of life between lives 2000 00028270 1567184995
  Nietzsche, Friedrich Wilhelm, 1844-1900 Nietzsche reader 1977 78300925 0140443290
  North Eastern Linguistic Society Proceedings of the Seventh Annual Meeting of the North Eastern Linguistic Society 1977 80494688  
  North, M. A. (Michael Arthur), b. 1865 Key to Latin prose composition 1979   0715614088
  North, M. A. (Michael Arthur), b. 1865 Latin prose composition 1997   0865163081
  North, M. A. (Michael Arthur), b. 1865 Latin prose composition for schools 1978   0715613219
  North, M. A. (Michael Arthur), b. 1865 Latin prose composition for schools 1978   0715613219
  Noveletsky-Rosenthal, Hollie T Pattern recognition in older adults living with chronic illness [microform] 1996  
  Noyer, Alain Surete de l'Etat, 1789-1965 1966  
  Nunes, Jorge Armando Nogueira, 1953- Translation, evoluðcäao tâecnica do violoncelo concerto re maior de Haydn by Jorge Armando Nogueira Nunes 1999  
  Nurik, Tracey Sue A study of Elisabetta Sirani and her works in american collections 1982  
  Nygren, Richard Edwin, 1964- Leadership of work teams : factors influencing team outcomes 1996  
  Oates, Joyce Carol, 1938- We were the Mulvaneys c1996 96017267 0525942238
  Oberthür, Sebastian Kyoto Protocol : international climate policy for the 21st century c1999 99045872 354066470X
  O'Conner, Patricia T Woe is I : the grammarphobe's guide to better English in plain English c1996 96011473 0399141960
  Oerberg, Hans H. (Hans Henning), 1920- Lingua Latina per se illustrata 1983-1985   8788073459
  Ogle, Robert R Crime scene investigation and physical evidence manual : manual of guidelines : crime scene search and physical evidence collection c1995 95197674  
  Oh, Sang-Ryong Korean numeral classifiers : semantics and universals 1994  
  Olsen, B-rad Extreme adventures, Northern California c1998   1556508085
  Olsen, B-rad World stompers : a young person's ultra-budget guide to travel c1996 96211332 1888729007
  Opera nazionale dopolavoro Costumi, musica, danze e feste popolari italiane .. 1935 39021559 //r84  
  Oppenheimer, Betty, 1957- Candlemaker's companion : a complete guide to rolling, pouring, dipping, and decorating your own candles c1997 97013119 088266994X
  Origen Contra Celsum 1953 53011716  
  Orr, C. W. (Charles Wilfred), 1893-1976 Shropshire lad : 7 songs c1934  
  Otero, Luiz Soledade, 1940- Butterflies : Beauty and behavior of Brazilian species c1990 93832370 8585352027
  Ouwinga, Marvin Dutch contribution to the European knowledge of Africa in the seventeenth century: 1595-1725 1975  
  Ovid, 43 B.C.-17 or 18 A.D Ovid's Metamorphoses : the original text reduced to the natural English order with a literal interlinear translation [1895?]  
  Pâeron, captain, b. 1769 Mâemoires du capitaine Pâeron [microform] : sur ses voyages aux cãotes d'Afrique, en Arabie, áa l'ãile d'Amsterdam, aux ãiles d'Anjouan et de Mayotte, aux cãotes nord-ouest de l'Amâerique, aux ãiles Sandwich, áa la Chine, etc    
  Pâeron, Franðcois, 1775-1810 Voyage de dâecouvertes aux terres australes : executâe sur les corvettes le Gâeographe, le Naturaliste, et la goèelette le Casuarina, pendant les annâees 1800, 1801, 1802, 1803, et 1804, sous le commandement du capitaine de vaisseau N. Baudin. Naviga 1812-1815 04032258  
  Page, Melvin E Health vs disease, a revolution in medical thinking [c1960] 61001889  
  Palacio, Pablo Un Hombre Muerto a Puntapies n.d  
  Palmer, Merril Jay Comprehensive performance project in choral conducting : with an essay on Henry Purcell's Dido and Aeneas, a comparison of editions, ornamentation of arias and selected recitatives and a conductor's analysis 1975  
  Pan, Qi Dewetting and phase separation... 1996  
  Pani, Alberto J., 1878-1955 Higiene en México 1916  
  Parasession on the Lexicon (1978 : Chicago, Ill.) Papers from the Parasession on the Lexicon, Chicago Linguistic Society, April 14-15, 1978 1978 78056478  
  Paredes, Manuel Rigoberto Provincia de Inquisivi : estudios geogrâaficos, estadisticos y sociales 1906  
  Parker, Dorian Leigh, 1920- Girl who had everything : the story of "the fire and ice girl" 1980 79007499 0385143311
  Parker, Leonard Emanuel, 1938- Creation of particles in an expanding universe : a thesis 1966  
  Parsons, Clare Olivia Women and the walk : female flãanerie and the aesthetics of public space in 19th century Europe 1996  
  Pataänjali Aphorisms of the Yoga philosophy of Patanjali : with illustrative extracts from the commentary by Bhoja Råajåa 1852-  
  Patañjali Aphorisms of the Yoga philosophy of Patanjali [microform] : with illustrative extracts from the commentary by Bhoja Raja 1852- 91908020  
  Paterson, Thomas G., 1941- American foreign relations : a history c1995 94077212 0669351555
  Patterson, David A Computer architecture : a quantitative approach 1996 95037027 1558603298
  Patterson, David A Computer architecture : a quantitative approach 1996 95037027 1558603298
  Patterson, Gerald R Coercive family process c1982   0916154025
  Patterson, Thomas E History of the Arkansas Teachers Association c1981 81004011  
  Paul, Ileana Malagasy Clause Structure 2000  
  Pearl, Eric Reconnection : heal others, heal yourself c2001 2001016545 1561708194
  Peckwas, Edward A Collection of articles on Polish heraldry c1978 78104716  
  Peltzer, Karl Clinical psychology in Africa : (south of the Sahara, the Caribbean and Afro-Latin America) : (a textbook for universities and paramedical schools)    
  Pèotz, Clemens Hellmut Wetterfahnen : mit einer Anleitung zum Selbstbau 280 historische und moderne Beispiele c1983   3766706640
  Perrett, Bryan, 1934- Panzerkampfwagen III medium tank : text by Bryan Perrett 1999   1855328453
  Perricone, Nicholas Wrinkle cure 2000   1579542379
  Petit, Fernand Notes sur l'Espagne artistique 1877  
  Philadelphia record (Philadelphia, Pa.: 1995) Philadelphia record 1995-  
  Phillips, Bill Body-for-life : 12 weeks to mental and physical strength c1999 99026145 0060193395
  Picard, Carol A Uncovering pattern of expanding consciousness in mid-life women [microform] : creative movement and the narrative as modes of expression 1998  
  Pierrard, Pierre Eglise et les ouvriers en France : 1840-1940 c1984 84205677 201005671X
  Pineau, Pablo Escolarizaciâon de la provincia de Buenos Aires, 1875-1930 : una versiâon posible 1997 98116717 9502904842
  Pinot de Villechenon, Marie Noèelle Sáevres : porcelain from the Sáevres Museum, 1740 to the present day c1997 00265872 0853316899
  Pisoni, Michael J Operatic war in New York, 1883-84 : Colonel James H. Mapleson at the Academy of Music vs. Henry E. Abbey at the Metropolitan Opera House c1975  
  Pisoni, Michael J Operatic war in New York, 1883-84 : Colonel James H. Mapleson at the Academy of Music vs. Henry E. Abbey at the Metropolitan Opera House c1975  
  Plato Plato : Republic, book I 1940  
  Plautus, Titus Maccius Aulularia of Plautus : The pot of gold c1988 gb 88060201 0582367530
  Plautus, Titus Maccius T. Maccii Plauti Amphitryo : comoedia c1976  
  Pol, Lotte van de Amsterdams hoerdom : prostitutie in de zeventiende en achtiende eeuw c1996 97174201 9028417508
  Pomey, J.-B. (Jean Baptiste), 1861- Cours d'electricitâe thâeorique, professâe áa l'Ecole professionnelle supâerieure des postes et tâelâegraphes 1914-1931  
  Poor, Walter A Differential geometric structures c1981 80019888 0070504350
  Popoviâc, Marko Stari grad Ras 1987 89135102  
  Post, Elizabeth L Emily Post's complete book of wedding etiquette c1991 90055548 0062700065
  Poulsen, Vagn, 1909- Etruskische Kunst. Hrsg. Vagn Poulsen [1969è  
  Powell, Deborah Ann, 1949- Retrospective case studies of individual and group decision making in district-level elementary reading textbook selection 1986  
  Prado, Manuel Conquista de la Pampa [microform] : cuadros de la guerra de frontera 1960  
  Prengel, Serge Still a dad : the divorced father's journey c1999 98096241 1892482002
  Prestamo, Anne M Comprehensive inventory of technology and computer skills for academic reference librarians [microform] 2000  
  Priest, Graham Introduction to non-classical logic 2001 00023609 0521790980
  Pulido y Fernâandez, Angel, 1852- Degeneraciâon del sâocio-sindicalismo : necesidad de su regeneraciâon higiâenica y moral [1921?]  
  Pyle, Robert Michael Watching Washington butterflies; an interpretive guide to the State's 134 species, including most of the butterflies of Oregon, Idaho, and British Columbia [1974] 73094500 0914516035
  Quann, C. James Plus (+) minus (-) grading : a case study and national implications 1987  
  Raffel, Markus, 1962- Particle image velocimetry : a practical guide c1998 97051315 3540636838
  Ramondino, Fabrizia, 1936- Storie di patio c1983 83204673 8806055801
  Rapp, Adam Nocturne : a play 2002, c2001 2001053151 0571211321
  Ravel, Maurice, 1875-1937 Concerto pour piano et orchestre : avec râeduction de l'orchestre pour un second piano c1932  
  RavenWolf, Silver, 1956- Teen witch : Wicca for a new generation 1998 98026071 1567187250
  Ray, James Lee Global politics c1998 97072534 0395872510
  Raynal, Jean Histoire des institutions judiciaires [1964] 66055403  
  Reaves, John A Influence of the founder on the Webb School of Knoxville : an application of Schein's theory of culture creation 1992  
  Reconco Murillo, Efraâin Honduras frente a la integraciâon econâomica : su historia y conflictos 1987 87406969  
  Reimarus, Hermann Samuel, 1694-1768 Gesammelte Schriften 1979-   3446127410
  Reiss, R. A. (Rodolphe Archibald), 1875-1929 Photographie judiciaire [1903]  
  Reiss, R. A. (Rodolphe Archibald), 1875-1929 Photographie judiciaire [1903]  
  Renteln, Alison Dundes International human rights : universalism versus relativism c1990 89024251 0803935056
  Revilla, Linda A., 1960- Manifestations of ethnic identity : Pilipino Americans 1989  
  Rezendes, Paul Tracking & the art of seeing : how to read animal tracks & sign 1999 98045867 0062735241
  Rhind, A. Henry (Alexander Henry), 1833-1863 Thebes, its tombs and their tenants, ancient and present : including a record of excavations in the Necropolis 1862 59000440  
  Richards, Donald Ray German bestseller in the 20th Century; a complete bibliography and analysis, 1915-1940 1968 70372601//r92  
  Richards, J. D Blood of the Vikings 2001   0340733853
  Riis, P. J. (Poul Jørgen), 1910- Etruscan types of heads : a revised chronology of the archaic and classical terracottas of Etruscan Campania and Central Italy 1981 83153698 8773041157
  Rinascimento a Venezia. English Renaissance Venice and the North : crosscurrents in the time of Bellini, Dürer, and Titian 2000 99080012 0847821951
  Ringgold, Faith, 1930- French collection part 1 = La collection fran÷caise I c1992  
  Robbins, Todd Jeffrey, 1963- Questioning the community question [microform] : Wal-Mart, place identity and a classic New England town 1998  
  Robbins, Todd Jeffrey, 1963- Questioning the community question [microform] : Wal-Mart, place identity and a classic New England town 1998  
  Robbins, Todd Jeffrey, 1963- Questioning the community question [microform] : Wal-Mart, place identity and a classic New England town 1998  
  Roberts, Michael Military revolution, 1560-1660; an inaugural lecture delivered before the Queen's University of Belfast [1956] 61038431 /L  
  Robinett, Betty Wallace Easy Latin crossword puzzles : quid pro quo c1999 99070527 0844284467
  Robuck, Thomas Durward Christ-hymn in Philippians : a rhetorical analysis of its function in the letter c1987  
  Rocard, Yves Électricité 1951 51001527  
  Rodale, J. I. (Jerome Irving), 1898-1971 Autobiography c1965  
  Rogers, Carla S How to get into the right dental school c1999 98028071 0844264547
  Rogers, L. C. G Diffusions, Markov processes, and martingales 2000 00269117 0521775949
  Rogers, L. C. G Diffusions, Markov processes, and martingales c1994- 94028241 0471950610
  Rothman, William Jeffrey Study of reverse transfer students at selected Ohio technical colleges 1991  
  Roux, Gayle M Phenomenologic study : inner strength in women with breast cancer ... 1993, c1994  
  Rozitchner, Leâon Freud y los lâimites del individualismo burguâes 1979   9682303540
  Rozitchner, León Desventuras del sujeto político : ensayos y errores [1996]   9879035089
  RSC/SCI International Conference on Flavours and Fragrances (1997 : Warwick, England) Flavours and fragrances c1997   0854047875
  Ruben, Brent D Communication and human behavior c1998 97027360 0205267696
  Rucker, Walter C. (Walter Clifford) River floweth on' : the African social and cultural origins of slave resistance in North America, 1712-1831 1999  
  Rudelle, Odile République absolue : 1870-1889 1982   2859440453
  Ruel, Pierre Commémoration du soixantième anniversaire de la première assemblée de la Société des Nations réunie à Genève le 15 novembre 1920 1980] 81113096  
  Ruetz, Michael "Ihr mèusst diesen Typen nur ins Gesicht sehen" (Klaus Schèutz, SPD) : APO Berlin, 1966-1969 c1980  
  Rugh, Wilson J Linear system theory c1996 95021164 0134412052
  Ruhlman, Michael, 1963- Making of a chef : mastering heat at the Culinary Institute of America 1997 97030078 0805046747
  Russell, Rex, 1941- What the Bible says about healthy living : three biblical principles that will change your diet and improve your health c1999   0800717686
  Samb, Amar Islam et l'histoire du Sâenâegal 1974 75508829  
  Samulski-Parekh, Mary M. V., 1952- Comprehensive study of the piano suite Goyescas by Enriques Granados [microform] 1988  
  Sandler, Wendy, 1949- Sequentiality and simultaneity in American Sign Language phonology [microform] 1987  
  Satåo, Aiko, 1923- Waga råogo 1997   416745002X
  Sattler, Jerome M Assessment of children c1992 92090724 0961820926
  Saunders, William, 1836-1914 Descriptive catalogue of plants in the exotic collection of the Department of Agriculture 1872 agr09002310  
  Savage, Dan Kid : what happened after my boyfriend and I decided to go get pregnant : an adoption story 2000, c1999   0452281768
  Schlingensief, Christoph, 1960- Talk 2000 c1998 98144507 3216303756
  Schmitz, Michael David Oriental influences in the piano music of Claude Achille Debussy 1995  
  Schneider, David I Brief course in QBasic : with an introduction to Visual Basic c1994 94004806 0024077410
  Schnell, Rainer, Dr Nonresponse in Bevölkerungsumfragen : Ausmass, Entwicklung und Ursachen 1997   3810018171
  Schroeck, F. (Franklin) Quantum mechanics on phase space c1996 95025631 0792337948
  Schwalbenberg, Alma Villegas Ego and ethnic identity development in Filipino adolescents : an Asian perspective 1993  
  Schwarz, Stephen C Energy and resource recovery from waste 1983 83013110 0815509596
  Schwarzbein, Diana, 1960- Schwarzbein principle vegetarian cookbook c1999 99015011 155874682X
  Science monthly (Paterson, N.J.) Science monthly    
  Scott, Ronald David Band music of Morton Gould 1997  
  Scully, Erik Paul Habitat, shell utilization, and the behavioral ecology of some populations of the hermit crab Pagurus longicarpus Say, 1817 1976  
  Seidenberg, Robert Father's emergency guide to divorce-custody battle : a tour through the predatory world of judges, lawyers, psychologists, and social workers in the subculture of divorce c1997 94092005 0965706206
  Seidler, Richard David, 1937- Bassoon concertos of Antonio Vivaldi c1974  
  Seiffert, Stephen Lyons, 1938- Johannes Brahms and the French horn 1968  
  Sekuliâc, Isidora, 1877-1958 Govor i jezik ; Mir i nemir 1985  
  Serafini, Luigi Codex seraphinianus 1983, c1981 83007076 0896594289
  Serials (Oxford, England) Serials : the journal of the United Kingdom Serials Group 1988- 90656021  
  Shafer, Susan, Dr Writing effective report card comments c1997 97198017 0590068822
  Sharken Simon, Judith, 1962- Five life stages of nonprofit organizations : where you are, where you're going, and what to expect when you get there c2001 2001026343 0940069229
  Sharp, Lynn Louise Rational religion, irrational science : men, women, and belief in French spiritism, 1853-1914 1996  
  Shattles, Bob Revival fire and glory : a Baptist minister recounts experiences with a new wave of God's glory c1999   1884369847
  Shell, Billy Joe Mechanism of oxygen transfer through a compost material [microform] 1955  
  Shingleton, Kathy J Effects of 360 degree feedback on trust c1999  
  Silberschatz, Abraham Operating system concepts c2002   0471417432
  Silver, Bethany Bernais Indicators of academic achievement : a structural equation model 1999  
  Simmer-Dvonch, Lynn Development and evaluation of a group treatment for sexually abused male adolescents 1998  
  Simpson-Courts, Gwen Peek Peer interaction as a teaching/learning strategy : its effects upon attitude, achievement, and metocognitive processing in a high school reading program 1985  
  Simsek-Caglar, Ayse German turks in Berlin : migration and their quest for social mobility 1994   0315947144
  Slawecki, Tania Maria An experimental investigation of surface segregation and phase separation... 1995  
  Sloan-White, Barbara Blonds c1984 85126047 0671508814
  Smith, Daryl Raymond Effect of transactive memory and collective efficacy on aircrew performance 1999  
  Smith, Gary, 1947 Apr. 21- How I trade for a living c2000 99038492 0471355143
  Smuts, Alice Boardman Science discovers the child... 1995  
  Society of Plastics Engineers. Technical Conference Conference proceedings [1983]- sn 88036200  
  Soifer, V. A Iterative methods for diffractive optical elements computation c1997 gb 97036927 0748406344
  Song, Qi-Gen Formulas for stress ratio and effective flange width of simple and continuous I, T and box beams 1984  
  Southard, Frank A. (Frank Allan), 1907- American industry in Europe 1931 31035397  
  Southern Conference on Language Teaching (1987) New challenges and opportunities : dimension, languages '87 : report of Southern Conference on Language Teaching c1988 88061503  
  Sparks, Nicholas Walk to remember c1999 99012079 0446525537
  Sparnaay, Hendrik Hartmann von Aue; studien zu einer biographie 1975   3534061292
  Spies, S. B Methods of barbarism? : Roberts and Kitchener and civilians in the Boer Republics, January 1900-May 1902 1977 78311673 0798107359
  Spindel Conference (13th : 1995 : University of Memphis) Spindel Conference 1995 : explanation in the human sciences c1996  
  Spinelli, Jerry Loser c2002 2001047484 0060001933
  Spitz, Chantal T Ile des reves âecrasâes 1991   2908405245
  Sprick, Randall S Teacher's encyclopedia of behavior management : 100 problems/500 plans c1995 95215276 1570350310
  Springer, Carsten, 1965- Paul Auster sourcebook 2001 2001029095 0820447668
  Starmach, Karol Euglenophyta ; Eugleniny 1983   8301037253
  Stars and stripes (European ed. : Weekend) Stars and stripes. Weekend    
  Steele, J. Michael Stochastic calculus and financial applications c2001 00025890 0387950168
  Stein, Edith, 1891-1942 Briefe an Hedwig Conrad-Martius [1960] 72201933  
  Steinberg, Kerri P Photography, philanthropy, and the politics of American Jewish identity 1998  
  Stewart, Maria W Meditations from the pen of Mrs. Maria W. Stewart, (widow of the late James W. Stewart,) [microform] now matron of the Freedman's hospital, and presented in 1832 to the First African Baptist church and society of Boston, Mass. First pub. by W. Lloyd 1879 nuc87735526  
  Stokes, Maura Ellen Categorical data analysis using the SAS system c2000 2001280004 1580257100
  Stone, Deborah A Policy paradox : the art of political decision making c1997 96052119 039396857X
  Storey, M. John, 1943- Storey's basic country skills : a practical guide to self-reliance 1999 99035895 1580171990
  Stratton, Patricia David, 1957- Factors that moderate and mediate outcome in children of alcoholics 1997  
  Stravinsky, Igor, 1882-1971 Tango : piano [c1941]  
  Strichartz, Robert S Way of analysis c2000   0763714976
  Strohmeyer, Sarah Bubbles in trouble 2002 2001054744 0525946497
  Stuckenbruck, Loren Theo "Do not worship me, worship God" : the problem of angel veneration in early Judaism and aspects of angelomorphic Christology in the Apocalypse of John 1994  
  Sullivan, Steve, 1954- Va va voom! : bombshells, pin-ups, sexpots and glamour girls c1995 95077537 1881649601
  Summer, Averill Discussion and analysis of selected unifying elements in Robert Schumann's Carnaval, opus 9 1979  
  Supath Kookiattikoon The syntax of classifiers in Thai 2001  
  Suzuki, Takashi Semilinear elliptic equations c1994   4762504122
  Sy, Tidiane Confrérie sénégalaise des mourides; un essai sur l'Islam au Sénégal [1969]  
  Systematics Association Species concept in palaeontology; a symposium [1956] 58001102  
  Talbot, Alfred Kenneth, 1916- History of the Virginia Teachers Association, 1940-1965 1981  
  Tan, Soo Tang Applied calculus c1994 93033269 0534935370
  Tasso, Torquato, 1544-1595 Discorso della virtáu feminile e donnesca 1997   8838913358
  Taylor, Joseph L., 1941- Several complex variables with connections to algebraic geometry and lie groups c2002 2002018346 082183178X
  Taylor, Marcia Baxter, 1951- Development of the measure of epistemological reflection 1983  
  Taylor, Timothy Dean Strange sounds : music, technology & culture 2001 2001041984 0415936837
  Tenglund, Amanda Effects of gender and ethnic identity of perceptions of diversity and fairness [microform] : exploring the importance of identity in organizational behavior 2000  
  Tettelbach, Stephen Thomas Dynamics of crustacean predation on the northern bay scallop, Argopecten irradians irradians 1986  
  Thomas, Bob, 1922- Joan Crawford, a biography c1978 78014250 0671240331
  Thomas, Vicki H Personality disorders and substance abuse : by patterns of comorbidity in an inpatient treatment population 1995  
  Thomas, W. Hugh (Walter Hugh), 1935- SS-1 : the unlikely death of Heinrich Himmler 2001 2001409468 1841153060
  Thomas, W. Hugh (Walter Hugh), 1935- Strange death of Heinrich Himmler : a forensic investigation 2002 2001048995 0312289235
  Thompson, Silvanus Phillips, 1851-1916 Calculus made easy : being a very-simplest introduction to those beautiful methods of reckoning which are generally called by the terrifying names of the differential calculus and the integral calculus 1998 98010433 0312185480
  Thorson, Kristine Stone wall secrets 1998 97049982 0884481956
  Tiley, W. Edward Using Clipper c1992 91067188 0880228857
  Tolman, William Howe, 1861- Social engineering; a record of things done by American industrialists employing upwards of one and one-half million of people, 1909 09006279  
  Tomioka, Satoshi, 1963- Focusing effects and NP interpretation in VP ellipsis [microform] 1997  
  Tomishima, Shelly A Factors and experiences in biracial and biethnic identity development 2000  
  Torres, Luis Alfredo, 1935- Bellos rostros 1973  
  Tribole, Evelyn, 1959- Intuitive eating : a recovery book for the chronic dieter : rediscover the pleasures of eating and rebuild your body image 1995 95004018 031213097X
  Triplett, Kathy, 1949- Handbuilt tableware : making distinctive plates, bowls, mugs, teapots, and more c2001 00063488 1579902049
  Tsvetaev, E. M Mestnye Sel§sko-Khoziaistvennye Muzei i ikh Organizatsiia 1928  
  Tucker, Marcia Not just for laughs : the art of subversion : [exhibition] Terry Allen ... [et al.], the New Museusm [1981?] 81081189  
  Tuleja, Tad, 1944- Looking south : framing Mexico in the tribal twenties 1997  
  Turner, Gerry Teen model fact book c1980 80018228 0671330225
  Tyler, Anne Back when we were grownups : a novel 2001 2001088107 0375412530
  Unesco Israel: ancient mosaics [1960] 60004113  
  United States. Army. 3d Division 3d Infantry Division in Korea 1953] 53061700  
  United States. Army. Corps of Engineers. Philadephia District Delaware River Dredging Disposal Study 1984  
  United States. Army. Corps of Engineers. Philadephia District Delaware River Dredging Disposal Study 1984  
  United States. Children's Bureau Child care arrangements of full-time working mothers 1959  
  United States. Congress. House. Committee on International Relations. Subcommittee on Africa Confronting Liberia : hearing before the Subcommittee on Africa of the Committee on International Relations, House of Representatives, One Hundred Seventh Congress, first session, March 14, 2001 2001   0160656184
  United States. Employment Standards Administration. Wage and Hour Division Education industry in Puerto Rico : an economic report 1976  
  Unschuld von Melasfeld, Marie Hand of the pianist. A systematic method for the attainment of a sure, brilliant piano-technic in the modern style according to the principles of Professor Th. Leschetitzky 1903  
  Unstead, J. F. (John Frederick), 1876- General and regional geography for students [1938,39]  
  Valin, Claudy Ligue des droits de l'homme en Charente-Maritime : des origines à nos jours c1988 89171594 2903504342
  Van Lier, Leo Interaction in the language curriculum : awareness, autonomy, and authenticity 1996 95039097 0582248795
  Vasconcelos, José, 1882-1959 Raza cósmica 1979  
  Vaughan Williams, Ralph, 1872-1958 English folk song suite c1924  
  Villey, Michel Cours d'histoire de la philosophie du droit 1962-  
  Virgil Aeneid IX 1979   0906515386
  Virgil Aeneid of Virgil. Books VII-XII 1897  
  Virgil Aeneid X 1990   1853990450
  Virgil P. Vergili Maronis Aeneidos, Libri VII-VIII 1990   0862921716
  Virgil Story of Camilla 1956  
  Viviáes, Albert Ame de la Cochinchine 1924 44038754  
  Wade, T. R. (Thomas Russell) Grammar of the Kashmåiråi language : as spoken in the valley of Kashmåir, North India 1995   8120610555
  Walas, Stanley M Reaction kinetics for chemical engineers 1959 59010727  
  Walls, Jean Marie Turcotte, 1957- Narrative and representation in French colonial literature of Indochina 1994  
  Wand, M. P. (Matt P.) Kernel smoothing 1995   0412552701
  Warner, Michael, 1958- Publics and counterpublics 2002 2001043527 1890951285
  Warner, Richard, 1943- Recovery from schizophrenia : psychiatry and political economy 1985 85002199 0710099797
  Watson, J. S. (John Selby), 1804-1884, tr Justin, Cornelius Nepos, and Eutropius 1910  
  Weber, James N Talking machine : the advertising history of the Berliner gramophone and Victor talking machine 1997 2001537710 0968215106
  Weeks, Dennis Francis, Ed.D A study of the effect of a Web based computer game on national certification examinations for dental hygiene students at Valencia Community College (Florida). 2000  
  Weinraub, Eugene J Chrâetien's Jewish grail : a new investigation of the imagery and significance of Chrâetien de Troyes's grail episode based upon medieval Hebraic sources 1976 75029182 0884380025
  Weizhong, Zhao Wetting, ordering and fluctuation phenomena in thin polymer films 1994  
  Wells, David (David Alan) Political ecologist c2000 99076343 0754611191
  Wenger, Win Discovering the obvious c1998   0931865530
  Werum, Regina E Political process in the pre-desegregation south : race and gender stratification in federal vocational programs, 1917-1936 1994  
  West, Larry Ketner, 1947- Cellular organization and biomineralization of the envelope of Trachelomonas hispida var. coronata 1977  
  Wharton, Jim, 1940- Whartons' cardio-fitness book : the step-by-step program for high energy and endurance c2000 00037725 0812931610
  Wheeler, Frank Charles Essential vocabulary of Virgil : arranged from the list of the College Entrance Examination Board in the order of first occurence in the Aeneid and alphabetically c1934 34002200  
  White, Christopher, 1930- Dutch pictures in the collection of Her Majesty the Queen 1982 81012268 0521242835
  Whitman, Ernestine Analysis and performance critique of Debussy's flute works 1977  
  Whitman, Walt, 1819-1892 Journalism c1998- 96041570 0820410195
  Whittall, Noel Paragliding : the complete guide [1998?] 97038329 1558216618
  Wilbur, HerveyB Materialism in its relation to the causes... 1872  
  Williams, L. K Lord! Lord! : special occasion sermons and addresses of Dr. L.K. Williams 1942  
  Wilmott, Paul Mathematics of financial derivatives : a student introduction 1995 95016466 0521496993
  Wilson, Robert McLiam, 1964- Eureka Street 1997 97025043 1559703962
  Wind, Maarten de, 1964- Inversion in French 1995 96209485  
  Windrow, Martin Greek hoplite c1985 84050020 0531037800
  Windrow, Martin Greek hoplite c1985 84050020 0531037800
  Winkiel, Laura A Passionate modernism : intellectuals, the masses and narrative rupture in twentieth-century novels and manifestoes 1999  
  Wolcott, Willa, 1942- Overview of writing assessment : theory, research, and practice c1998 98017197 0814134904
  Wolf, Erik, 1902- Problem der Naturrechtslehre: Versuch einer Orienterierung 1959  
  Wolfe-Ralph, Carol Anne Passion of Spain : the music of twentieth-century Spanish composers with special emphasis on the music of Enrique Granados 1995  
  Wood, Elizabeth Anne Working in the fantasy factory : interaction, intimacy and the construction of power in strip clubs 1999  
  Wood, Robert, 1717?-1771 Essay on the original genius and writings of Homer, with a comparative view of the ancient and present state of the Troade 1824   0843401540
  Woods, Benjamin North American piano sonata in transition from tonal to atonal styles 1991  
  Worgs, Donn Christopher Politics, economics and culture in the production of African American and Native American education 2000  
  Wu, San-Jarn, 1957- Literary study of Isaiah 63-65 and its echo in Revelation 17-22 [microform] 1995  
  Wurgler, Pamela Sewell, 1949- Perceptual study of vocal registers in the singing voices of children 1990  
  Wyzewa, Teodor de, 1862-1917 Grands peintres de l'Allemagne, de la France (pâeriode contemporaine), de l'Espagne et de l'Angleterre : suivi de l'histoire sommaire de la peinture japonaise 1891  
  Yannay, Yehuda, 1937- Toward an open-ended method of analysis of contemporary music microform : a study of selected works by Edgard Varèse and György Ligeti 1974  
  Yi, Kwang-gyu, 1932- Kinship system in Korea 1975 76368464  
  Yoshioka, Hirosuke Sesquiterpene lactones; chemistry, NMR and plant distribution [1973] 74178545//r85  
  Younes Fracture distribution in faulted basement blocks, Gulf of Suez, Egypt 1996  
  Yu, Seung Won, 1959- Paul's pneumatic epistemology : its significance in his letters 1998  
  Zeballos, Estanislao Severo, 1854-1923 Viaje al país de los araucanos 1934 37008439  
  Zubiaur, Josâe Benjamâin, 1856- Sinopsis de la educacion en la Republica Argentina .. 1901  
  Zuccari, Carlo True method of playing an adagio [MICROFORM] : made easy by twelve examples : first, in a plain manner with a bass then with all their graces : adapted for those who study the violin [17--?]  
  Zwemer, Samuel Marinus, 1867-1952 Duty of conclusive thinking on great subjects 1920  
10/22/2002   1


 
URL: http://www.libraries.rutgers.edu/rul/staff/access_serv/reports/call_num_reports_01-02b.shtml
Website Feedback  |  Privacy Policy
© Copyright 1997-, Rutgers University Libraries