Call Number /Title Summary Report as Borrower
January 1, 2002 to March 31, 2002

    Call Number /Title Summary Report as Borrower      
    January 1, 2002 to March 31, 2002      
Report Summary:          
Call Number Range: All        
Number of titles reported: 1607        
Call Number Author Title Publication LCCN ISBN
      Date    
    ANTEC 2001 conference proceedings     1587160986
    Emerging technologies, current practices, quality control, technology transfer, and environmental issues : volume I in the proceedings of the world conference on oilseed and edible oils proceedings 1998   0935315837
    Iskhod k Vostoku : predchuvstviia i sversheniia : utverzhdenie evraziitsev 1921    
    Verteilungsnetze im liberalisierten Markt 2000   3800725770
  Petras, James F Globaloney : el lenguaje imperial, los intelectuales y la izquierda 2000   9879306082
  World Conference on Earthquake Engineering (11th : 1996 : Acapulco, Mexico) Eleventh world conference on earthquake engineering 1996   0080428223
*oversize N6537.K8 T6 ((FTaSU) main,hum) Kokuritsu Kindai Bijutsukan (Japan) Kuniyoshi; catalogue of Kuniyoshi's posthumous exhibition under the auspices of the National Museum of Modern Art, Tokyo and the Mainichi newspapers, March 20-April 25, 1954 c1954] 56003256  
*XML-2165 Lee, Hyeweon Olivier Messiaen's Vingt regards sur l'Enfant Jésus [microform] : a study of sonority, color and symbol c1992    
*ZB-3637 Moe, Orin, 1943- Texture in the string quartets of Haydn to 1787 [microform] 1970, c1971    
*ZT-855 Bourguin, Maurice De l'application des lois ouvrières aux ouvriers et employés de l'?tat ... [Microform] 1902    
\100.12\M97 (S) (TWC) Museum of Modern Art (New York, N.Y.). Library Political art documentation & distribution : the PADD Archives : exhibition, June 1993-May 1994 1994    
\107.1\N4839\no.[18]\box (S) New Museum (New York, N.Y.) Not just for laughs : the art of subversion [1981] 81081189  
\131.1M58\R242\Q (S) Redig de Campos, D. (Deoclecio) Giudizio universale di Michelangelo 1944 49058236  
\131.9Ay1\Ay1 (S) Aycock, Alice, 1946- Alice Aycock : projects and proposals, 1971-1978, [exhibition, December 3, 1978 - January 13, 1979 : Muhlenberg College, Center for the Arts] 1978    
\146.42\N39 (S) Neuwirth, Waltraud Josef Hoffmann : Bestecke für die Wiener Werkstätte 1982 83164511 3900282188
\175L831\C48 (S) Ciardi, Roberto Paolo Aurelio Lomi : maniera e innovazione c1989    
\315.09\C99 (S)   Cyberarts : exploring art & technology 1992 92060950 0879302534
\373.73\M33\ (MAIN) \f\ Marcus, Lloyd, 1924- Founding of American private progressive schools, 1912-1921 1948    
\509.8B83\B67 (S) (GR) Herbert, Kevin Ancient art in Bowdoin College; a descriptive catalogue of the Warren and other collections 1964    
\579.5\A5123A\ \Storage\ American Genetic Association Annual report, American breeders' Association      
\616.3\H97g Hurst, Arthur F. (Arthur Frederick), 1879-1944 Gastric and duodenal ulcer 1929 a 30000380  
\617.4\M94 Moynihan, Berkeley Moynihan, Baron, 1865-1936 Duodenal ulcer 1910 10009932  
\624.4\C73 (S) Comella, Annamaria Materiali votivi del Santuario di Campetti a Veio : scavi 1947 e 1969 1990   8876890394
\808.3\F216   Fantasists on fantasy : a collection of critical reflections 1984   038086553X
\809\G984mn\1973 Guthrie, William Norman, 1868-1944 Modern poet prophets; essays: critical and interpretative 1973 72006115 //r89 0841401047
\80-904032 (CRLL)   Original yoga : as expounded in Siva-samhita, Gheranda-samhita, and Pta~njala Yoga-sutra 1980, c1979 80904032  
\820.8\T823   Trials, tribulations, and celebrations : African-American perspectives on health, illness, aging, and loss c1992 91037596 //r93 1877864005
\828\G662b Gordon, Armistead Churchill, 1855-1931 Befo' de war; echoes in negro dialect 1888 a 10000601  
\828\R49555de Rice, Christopher, 1979- Density of souls c2000 00035072 0786866462
\838\S89O\G59 Göhler, Ch Leben für die Graue Stadt 1987    
\839.35\G393xb Gestel, Frank C. van X-bar grammar : attribution and predication in Dutch 1986   9067652512
\839.5\D365in Delsing, Lars-Olof Internal structure of noun phrases in the Scandinavian languages : a comparative study 1993   9162809881
\848\M368du Marquet, Jean, 1883- Du village à la cité; moeurs annamites [192-]    
\868\L85865se\1998 López Nieves, Luis, 1950- Seva : historia de la primera invasión norteamericana de la Isla de Puerto Rico, occurida en mayo de 1898 1998    
\868\P149hm\1971\ Palacio, Pablo Hombre muerto a puntapiés : Débora 1971 72324934  
\870.4\W937Li Woudhuizen, Fred Linguistica tyrrhenica : a compendium of recent results in Etruscan linguistics 1992   9050630812
\891.78\B961fr\1994 Burliuk, David, 1882-1967 Fragmenty iz vospominanii futurista ; Pis'ma ; Stikhotvoreniia 1994   5857670640
\9290\.903\.12 (ANXB) Thompson, Silvanus Phillips, 1851-1916 Dynamo-electric machinery 1884    
\AS\182\.B517\A3\no.59,62   Buddhistisches Yogalehrbuch 1964-1966 80454194//r89  
\B\3998\.C49 Alain, 1868-1951 Spinoza [1949]    
\BF\511\.E941\1995   Everyday conceptions of emotion : an introduction to the psychology, anthropology, and linguistics of emotion c1995 95013602 0792334795
\BS\1199\W7B5.7\1997 (MAIN) Bird, Phyllis A. (Phyllis Ann), 1934- Missing persons and mistaken identities : women and gender in ancient Israel c1997 97027404 0800631285
\BS\537\.L66\1997 London Conference on the Rhetorical Analysis of Scripture, (1995 : Pepperdine University) Rhetorical analysis of Scripture : : essays from the 1995 London Conference c1997 98101988 1850756716
\BT\1120\.W72 Williams, Arthur Lukyn, 1853- Adversus Judaeos 1935 36011257  
\BV\4012.2\F5.73\1993 (MAIN) Fitchett, George Spiritual assessment in pastoral care : a guide to selected resources 1993 93159540 0929670078
\BX\4705\.M795\N44\2000 Neenan, Benedict Thomas Verner Moore : psychiatrist, educator, and monk c2000 00062321 0809139871
\CJ\987\.B371\1992 Bastien, Pierre, numismatist Buste monétaire des empereurs romains 1992- 93122993  
\Communism\12445 Beals, Carleton Rifle Rule in Cuba 1935    
\D\No.48\Pt.5 (MICF) Baugher, Peter Frederic, 1945- Contradictions of colonialism [microform] : the French experience in Indochina 1980    
\DA\25\.D346\1971\Suppl.\1977 Great Britain. Public Record Office Calendar of the general and special assize and general gaol delivery commissions on the dorses of the patent rolls : Richard II (1377-1399) 1977    
\DC\340\.V77\1989 Vindé, François Affaire des fiches : 1900-1904 : chronique d'un scandale c1989   2711303896
\DP\185.9\.E59\G64 González Moreno, Joaquín Don Fernando Enríquez de Ribera, tercer duque de Alcalá de los Gazules, 1583-1637; estudio biográfico 1969    
\DS\489.25\.T3\R3471\1998 Rajasuriar, G. K History of the Tamils and the Sinhalese of Sri Lanka 1998] 99940491 0646365703
\DT\57\.B861\no.39 Petrie, W. M. Flinders (William Matthew Flinders), Sir, 1853-1942 Ancient weights and measures 1926 27022865  
\F\3126\.A691\1979 Alonqueo P., Martín Instituciones religiosas del pueblo mapuche : Ngillathún, Ul.uthún, Machithún y Ngeikurrehwen [1979] 82159686 //r942  
\Film\1139 Trimmer, Maud Alice Texture and sonata form in the late string chamber music of Haydn and Mozart [microform] 1981    
\Film\22 Bugbee, Bruce Willis Early American law of intellectual property [microform]: the historical foundations of the United States patent and copyright systems      
\FILM\31416(5) Sociedad universitarias argentinas de Buenos Aires Cargos a la Comisión directiva del Consejo nacional de mujeres [microform]      
\FILM\32797   Customs 3 (1696-1780) in the Public Record Office, London [microform] 1974    
\FILM\32797   Customs 3 (1696-1780) in the Public Record Office, London [microform] 1974    
\Film\An\T634 (MIC)   Globe and mail   sn 84007692  
\FILM\X442 Detroit free press (Detroit, Mich. : 1837) Detroit free press [microform] 1837- sn 83016733  
\FL8\A7.9\B826d\1930 Bravo, Mario, 1882- Derechos políticos de la mujer; proyecto de ley presentado en la sesión del 25 de septiembre de 1929 1930 37012007  
\G\70.212\.L36\2000 Lang, Laura GIS for health organizations c2000   187910265X
\GN\470\.R87 Roux, Jean-Paul, 1925- Faune et flore sacrées dans les sociétés altaïques 1966 67071899  
\Gt Brit\Stat \FOLIO\ Great Britain Statutes of the realm 1993    
\HD\1333\.H8\H661\1992   Honduras, el ajuste estructural y la reforma agraria 1992 93150209  
\HD\1995.15\.N55\1995 Nikonov, A. A Spiral' mnogovekovoi dramy : agrarnaia nauka i politika rossii (XVIII-XX vv.) 1995   5883670024
\HD\6524\.C59511\1989   Collective bargaining in Canada 1989   017603417X
\HD\77\.I581\1997   International development and the social sciences : essays on the history and politics of knowledge c1997 97026697 0520209567
\HdCpy (CRLS)   Journal of the Royal Army Medical Corps   sf 80001521  
\He94p\135r (SY) \Porto\Rico\ Burgos, Julia de, 1914- Poemas de 20 surcos 1938 39018514  
\HG\106\.F731\2000 Franses, Philip Hans, 1963- Nonlinear time series models in empirical finance 2000 99088504 0521770416
\HG\4515.15\.A381\1993   Advances in behavioral finance c1993 93012149 0871548453
\HM\1\.C356\no.107 Cole, Jeffrey, 1958- New racism in Europe : a Sicilian ethnography 1997 97004075 0521584930
\HM\276\.F16 Faguet, Emile, 1847-1916 Libéralisme .. 1903 03014334  
\HT\167\.B43\1994 Beaumont, Constance Epton, 1943- How superstore sprawl can harm communities and what citizens can do about it c1994    
\HX\40\.W22 (UGL) \HX\40\.W22 Walling, William English, 1877- Socialists and the war; a documentary statement of the position of the socialists of all countries; with special reference to their peace policy, including a summary of the revolutionary state socialist measures adopted by the governments at war 1915 15013196  
\JFC\73-4516 Caminade, Pierre Journal d'une tendresse 1972] 73327859  
\JFE\94-4581 Webster, Brenda S Sins of the mothers : a novel c1993 93070943 1880909057
\JN\2562\.H16 Halbecq, Michel État: son autorité, son pouvoir (1880-1962) 1965    
\JQ\200\.S54 Sharma, Ram Sharan, 1920- Indian feudalism: c. 300-1200 1965 sa 67004020  
\K\3585\.O241\1999 Oberthür, Sebastian Kyoto Protocol : international climate policy for the 21st century c1999 99045872 354066470X
\KD\606\.B741\1979 British Legal History Conference (4th : 1979 : University of Birmingham) Law, litigants, and the legal profession : papers presented to the Fourth British Legal History Conference at the University of Birmingham, 10-13 July 1979 1983 83222934//r87 0391029258
\KW16\B47\F7 (BAS) Bircher, Paul From the Companies Act of 1929 to the Companies Act of 1948 : a study of change in the law and practice of accounting 1991 90021475 0815300026
\LB\1042\.N441\1994   Need for story : cultural diversity in classroom and community c1994 93047953 0814133002
\LB\1573\.C1861\1998 Calkins, Lucy McCormick Teacher's guide to standardized reading tests : knowledge is power c1998 98172906 032500000X
\LD\2154\.A3\1903 Harvard University Official guide to Harvard university 1903 03016807  
\MT\239\.P7511\1991 Price, Deon Nielsen Accompanying skills for pianists c1991    
\N44\M268\ ND.T7l (WEST) Lloyd, Christopher Hamilton Andrea Mantegna, the Triumphs of Caesar : a sequence of nine paintings in the Royal Collection 1991 gb 91031451 011290503X
\NB\110\.S26\1994 Sannibale, Maurizio Urne cinerarie di età ellenistica / di Maurizio Sannibale c1994   8870628329
\NB\118\.E3\G74 Graindor, Paul, 1877-1938 Bustes et statues-portraits d'Égypte romaine [1939?] ac 39003336 //r  
\P\No.90 (MICF) Chalfin, Norma Jean, 1941- Walt Whitman's philosophy of history 1975    
\PL\2677\.L65\C67 Zhou, Chengzhen, 1923- Li He lun 1971    
\PM6773\ .A22\vol. 4 (F) Russell, Robert Lee, 1925- Gramática transformacional del amahuaca 1975 77552625  
\PQ7798\.1\.G814 xC7\1977 (F) Aguinis, Marcos Cruz invertida c1977    
\PR6058\.A9855\ Z47 \1988 (F) Haymon, S. T Opposite the Cross Keys c1988 87038239 0312018037
\QA\278.2\.N461\1996   Applied linear regression models c1996 95037444 025608601X
\QA\31\.D593\Zz\H438\1910 Heath, Sir Thomas Little, 1861- Diophantus of Alexandria, a study in the history of Greek algebra 1910 12009157  
\QA\76.9\.M35\C481\1998 Chaitin, Gregory J Limits of mathematics : a course on information theory and the limits of formal reasoning c1998 97036103 981308359X
\QC\176.8\.R3\B341\1998 Baier, V. N. (Vladimir Nikolaevich) Electromagnetic processes at high energies in oriented single crystals c1998 98216119 9810216033
\QD\380\.B56\1992 (ENGN) \QD\380\.B56\1992   Biodegradable polymers and plastics c1992   0851862071
\QE\696\.P25\1999   Paleoenvironmental reconstruction in arid lands 1999   9054107103
\QH\506\.M451\v.126   Adrenergic receptor protocols c2000 99034211 0896036022
\QH\87.3\.B56\2000   Biodiversity in wetlands : assessment, function and conservation 2000   9057820595
\QK\623\.A1\S62\1984\\ \Herbar\ Sivanesan, A Bitunicate Ascomycetes and their anamorphs 1984,c1983   3768213293
\QL\368\.T76\D3\1926 Deflandre, Georges Monographie du genre Trachelomonas Ehr. 1926    
\QL\696\.C42\F851\1999 Fuller, Errol Great auk 1999 99024632 0810963914
\QM\311\.I6217\1986 International Symposium on Dental Morphology (7th : 1986 : Paris) Teeth revisited : proceedings of the VIIth International Symposium on Dental Morphology, Paris 20-24 Mai 1986 1988   2856531482
\RC\341\.B741\1991 Breggin, Peter Roger, 1936- Toxic psychiatry : why therapy, empathy, and love must replacethe drugs, electroshock, and biochemical theories of the "new psychiatry" 1991 91000113 0312059752
\RC\451.4\.M47\R4411\1994 Reiss, Steven Handbook of challenging behavior : mental health aspects of mental retardation c1994 94077561 0964259818
\RZ\440\.T441\1999   Textbook of natural medicine 1999 99022324 0443059454
\SB\43\.S26 Saunders, William Papers on horticultural and kindred subjects 1891 agr09002349  
\T1985\.W869\ (MUS) Wolverton, Vance D Classifying adolescent singing voices 1985    
\TA\167\.A9651\1998   Automation technology and human performance : current research and trends 1999 98030954 0805831355
\TK\2181\.T476\1893 Thompson, Silvanus Phillips, 1851-1916 Dynamo-electric machinery [1893] 08000709  
\TK\5102.5\.N471\1994   Neural networks in telecommunications c1994 93033665 0792394178
\TP\1160\.H361\1997   Handbook of plastics joining [electronic resource] : a practical guide c1997   1591240476
\TR\830\.B54 Bertillon, Alphonse, 1853-1914 Photographie judiciaire : avec un appendice sur la classification et l'identification anthropométriques 1890 03016340  
\TX\361\.A3\N88\1992   Nutrition in the elderly : the Boston Nutritional Status Survey 1992   1854630253
\Z\674.2\.I5581\1996 International Conference on Research in Information Needs, Seeking and Use in Different Contexts (1996 : Tampere, Finland) Information seeking in context : proceedings of an International Conference on Research in Information Needs, Seeking and Use in Different Contexts, 14-16 August, 1996, Tampere, Finland c1997 gb 97071482 0947568719
029.7 W151 Walker, Alfred J HRIS development : a project team guide to building an effective personnel information system c1982 82002616 0442290039
0412.89.23 (ANXA) 0412.89.23 Cambridge University Library Catalogue of the Syriac manuscripts preserved in the library of the University of Cambridge, by the late William Wright 1901 03007371  
06 no. 11409 (SCEDD) Hindin, Toby Jane Development and evaluation of a nutrition education intervention on head start parents' ability to mediate the impact of tv food advertising to their children 2001    
1.4 C52r Clayson, Hollis, 1946- Representations of prostitution in early Third Republic France c1984    
1413.784 (MAP) 9086.777 Robinson, Adrian Henry Wardle, 1925- Marine cartography in Britain: a history of the sea chart to 1855 1962 64001020  
1630.914 (NjP ANXA)   [Tridtsatye gody. Stat'i 1931 53050631  
272.2\.T662 Tomson, Robert, b. ca. 1533 Englishman and the Mexican Inqvisition, 1556-1560 1927 28004255  
300.41\D437\No.123 \Quarto\ Weinberg, Eve Community surveys with local talent: a handbook [1971] 77148016  
3167.8853.384 (NjP F) Cabezas, Juan Antonio, 1900- Secreto 1966 67059380  
323.2 D467 (PU vanp) Desjardins, Arthur, 1835-1901 De la liberté politique dans l'état moderne 1894 11002652 /A  
351\.C132 Cahen-Salvador, Georges, 1875- Fonctionnaires, leur action corporative 1911 11012535 //r  
378.493\B838 Brussels. École coloniale Extrait du reglement et programme des cours 1923    
378.82\C2E3 Sagarna, Antonio Fraternidad (hija del "Histórico"-heredera de Urquiza) 1944 44007676  
3781 1990 D (UARCH) 3781 1990 D Dickason, Margaret Jean Alcohol use in Emile Zola's Rougon-Macquart 1990    
3781 1998 B (CSt SAL STACKS) 3781 1998 B (CSt SPEC-COLL U-ARCHIVES) Bell, Genevieve Telling stories out of school: remembering the Carlisle Indian Industrial School, 1879-1918 1998    
3781 2000 H (CSt ART STACKS) 3781 2000 H (CSt SPEC-COLL U-ARCHIVES) Hutton, Molly Suzanne Ashcan city : representational strategies at the turn-of-the-century 2000    
3781\1991\E (ENGD) 3781\1991\E El-Fadel, Mouhtassem Modeling gas and heat generation and transport in sanitary landfills 1991    
3781\1993\L (UARCH) 3781\1993\L Lim, Phillip Wonhyuk Privatization of species : an economic history of biotechnology and intellectual property rights in living organisms 1992, copyright 1993    
3781\1995\U (UARCH) 3781\1995\U Uyechi, Linda Ann N Geometry of visual phonology 1994    
3792.5.3875 (NjP F) Hughes, Langston, 1902-1967 Simple stakes a claim c1957 57009628 /L  
459.2 Sa56s Sandfeld, Kristian, 1873- Syntaxe roumaine 1936-1960    
508 B29   Antiquities from the Collection of Christos G. Bastis 1987   3805309511
515\Ex76\V.5 Cartan, Élie Joseph, 1869- Méthode du repère mobile, la théorie des groupes continus et les espaces généralisés 1935 35015869  
5250.361.61 (NjP ANXA) Die Makkabäer (Middle High German poem) Buch der Maccabäer in mitteldeutscher Bearbeitung 1904 05016243 //r  
53271180 Ridgefield (Conn.) Aldrich Museum of Contemporary Art 26 contemporary women artists      
537.8 S200 (ICU JCL SciDDC) Timbie, W. H. (William Henry), b. 1877 Principles of electrical engineering 1922 22007092  
537.812 B244 (STOR) Barkhausen, Heinrich, 1881- Elektronen-röhren 1924-1929 25010277  
573.7 D613 (PU vanp) Dingwall, Eric John Artificial cranial deformation : a contribution to the study of ethnic mutilations 1931 32019798  
575\C764 Conrad, Hedwig (Martius), 1888- Ursprung und aufbau des lebendigen kosmos 1938 46039300  
581.612\V537 Veitch, James Herbert, 1868-1907 Hortus Veitchii; a history of the rise and progress of the nurseries of Messrs 1906    
595.701\C775 Cooke, Matthew Treatise on the insects injurious to fruit and fruit trees of the state of California : and remedies recommended for their extermination 1881    
610.71 H197 \quarto\ French Indochina. Direction de l'instruction publique École de plein exercice de médecine et de pharmacie de l'Indochine 1931    
616.33 C582 Cleave, T. L Peptic ulcer; a new approach to its causation, prevention, and arrest, based on human evolution 1962 63003094  
616.33 S302 (ICU JCL SciDDC) Moynihan, Berkeley Moynihan, Baron, 1865-1936 Two lectures on gastric and duodenal ulcer; a record of 10 years' experience 1923 sg 24000037 //r  
616.8 A8487m ((FTaSU) scie) Association for research in nervous and mental disease Military neuropsychiatry 1946 med47000695  
6250.266 (NjP F) Conrad-Martius, Hedwig, 1888- Metaphysische Gespräche 1921    
634.2 W63 1891 Wickson, Edward James, 1848-1923 California fruits and how to grow them. : A manual of methods which have yielded greatest success: with lists of varieties best adapted to the different districts of the state. 1891    
677.4 B864s ((FU) main) Brockett, Linus Pierpont, 1820-1893 Silk industry in America : a history : prepared for the Centennial exposition 1876 04032422  
709.37 H269 (PU vanp) 709.37 H269 (PU muse) Dumbarton Oaks Catalogue of Greek and Roman antiquities in the Dumbarton Oaks collection 1956 56001351  
709.73 Sm62m   Mimi Smith, television drawings : the Art Center, Waco, Texas, November 15-December 7, 1980 c1980 80070451  
71 O83   Over exposed : essays on contemporary photography 1999 99081357 1565845226
711\Se91 Sexby, John James Municipal parks, gardens, and open spaces of London: their history and associations 1898 03011521  
720.9794 L879k (S4) Kaplan, Sam Hall LA, lost & found : an architectural history of Los Angeles c1987 86013526 0517561840
724.937 L86op (S)   Kontroversen : Adolf Loos im Spiegel der Zeitgenossen c1985   3853670423
730.945 B52z (S4) Zollikofer, Kaspar Berninis Grabmal für Alexander VII. : Fiktion und Repräsentation 1994   3884621025
759.5 G34bi 1984 (AR) Bissell, R. Ward Baroque painter Orazio Gentileschi: his career in Italy 1966    
759.93\R823.yMi Millar, Oliver Rubens: the Whitehall ceiling 1958 58003821 /L  
77 R63 xV43 1991 Rodchenko, Aleksandr Mikhailovich, 1891-1956 Future is our only goal : Aleksandr M. Rodchenko, Varvara F. Stepanova c1991   3791311344
770.973 M823d (S3) Moore, Peter, 1932-1993 Destruction of Penn Station : photographs by Peter Moore 2000   1891024051
804 N87o Noyes, Alfred, 1880-1958 Opalescent parrot, essays 1929 30012121  
808 Su2 Süss, Wilhelm, b. 1882 Ethos, studien zur älteren griechischen rehetorik 1910 46039902  
813 B963T (PU vanp) Busch, Niven, 1903- They dream of home [1944] 44009917  
822P33\O5 Pecock, Reginald, 1395?-1460? Reginald Pecock's Book of faith; a fifteenth century theological tractate 1909 a 10002542  
823 T218C (PU vanp) Taylor, Stanley Arthur Goodwin, 1895- Capture of Jamaica; [1951] 51040024  
830.5\.G373 v.41 Wolter, Emil, 1886- St. Galler Spiel vom Leben Jesu 1912    
831H25\DO Ohly, Walter, 1931- Heilsgeschichtliche Struktur der Epen Hartmanns von Aue [1958]    
844M348 OJ Marquet, Jean, 1883- Jaune et le blanc 1932    
858 B724P (PU vanp) Bracco, Roberto, 1862-1943 Piccolo santo c1910 10008911  
87H78\HW32 Watkins, Roy Edward, 1912- History of paragraph divisions in Horace's Epistles 1940] 40034462  
888.4\.V1ad (CLAS) 888.4\.V1ad Plato Republic of Plato 1902 03031460  
889.1C K892 (PU vanp)   Vyzantina hippotika mythistoremata c1955 65044880  
88H75\DB87 Bulas, Kazimierz Illustrations antiques de l'Iliade 1929 33001420  
892.3 H282 \quarto\ Hatch, William Henry Paine, 1875- Album of dated Syriac manuscripts 1946    
8954.258 vol.49 (NjP f)   Cultures of psychiatry and mental health care in postwar Britain and the Netherlands 1998   9042006528
91/61490 (CRLL) (CRLG) \SAMP\ Patañjali Aphorisms of the Yoga philosophy of Patanjali [microform] : with illustrative extracts from the commentary by Bhoja Raja 1852- 91908020  
915.9 M14 McDonald, N. A Siam: its government, manners, customs, &c. 1871    
917.3 C423r Cherne, Leo M., 1912- Rest of your life 1944 44005464  
942.06\P38bp Penn, Granville, 1761-1844 Memorials of the professional life and times of Sir William Penn .. 1833 08028778  
96 14859 Herbert, Ulrich, 1951- Best : biographische Studien über Radikalismus, Weltanschauung und Vernunft, 1903-1989 c1996 96155394 //r962 3801250199
98-\566 Ssekamwa, J. C History and development of education in Uganda 1997 97950366  
9ZAR10D05S10TFG Wright, Grace Stevens Core program : abstracts of unpublyshed research, 1946-1955 1956    
9ZAR10D09S07TPH Fry, Bernard Mitchell, 1915- Library organization and management of technical reports literature 1953 a 53009952  
A17.18/4: 95-01 ((FTaSU) main,doc) Makuch, Joe Nonpoint-source pollution issues : January 1990 - November 1994 [1995]    
A27n\+15\44   Numismatique antique : problèmes et méthodes, actes du colloque organisé à Nancy du 27 septembre au 2 octobre 1971 par l'Université de Nancy II et l'Université Catholique de Louvain 1975   2801700037
AA3750\As7833 Associazione italiana per lo studio e la conservazione del mosaico. Colloquio (6th : 1999 : Venice, Italy) Atti del VI Colloquio dell'Associazione italiana per lo studio e la conservazione del mosaico ... : Venezia, 20-23 gennaio 1999 c2000   8875673705
AC5 .C7317 2001 (NjP f)   Company of readers : uncollected writings of W.H. Auden, Jacques Barzun, and Lionel Trilling from The Readers' Subscription and Mid-Century book clubs c2001 2001023188 0743202627
AM231 +P87X\1992\(LC) (SML) AM231 +P87X\1992\(LC) Purcell, Rosamond Wolff Finders, keepers : eight collectors 1992 91021055 0393030547
AMG2062 Meichenbaum, Donald Treating post-traumatic stress disorder : a handbook and practice manual for therapy 1997   047197241X
AN (Hansen) (Taylor, R. S. To plant the prairies and the plains) Taylor, H. J., Mrs., b. 1863 To plant the prairies and the plains : the life and work of Niels Ebbesen Hansen 1941    
AN (Pintard) (Wilson, J. G. John Pintard, founder of the New York Historical Society) Wilson, James Grant, 1832-1914 John Pintard, founder of the New York Historical Society; an address delivered before the New York Historical Society December 3, 1901 1902 02011389  
Archives Thesis 2001 M465 (rmc) Thesis ML 30 2001 M465 (mus) Meniker, Zvi, 1973- Aspects of performance practice in Frederic Chopin's piano works : slurs, pedalling, mazurka rhythm c2001    
AS182.S113 A621\no.80 (LAW) KJV5052 .L53\1975 Leistner, Georg Streik im öffentlichen Dienst Frankreichs 1975 75509412 3452179141
AS281 .D2144\9\5 \Quarto\ Riis, Poul Jørgen, 1910- Etruscan types of heads : a revised chronology of the archaic and classical terracottas of Etruscan Campania and Central Italy 1981   8773041157
AS36 .R295x no.3376 (P)   Method for the detailed assessment of the appropriateness of medical technologies 1991    
ATM3501 Khan, Iftikhar Ali History of the ruling family of Sheikh Sadruddin, Sadar-i-Jahan of Malerkotla, 1449 A.D. to 1948 A.D. 2000 00289770 8173806691
ATZ2728   What revels are in hand? : assessments of contemporary drama in English ; in honour of Wolfgang Lippke 2001   3884764624
B1247 .H62 1992   Hobbes e Spinoza, scienza e politica : atti del Convegno internazionale, Urbino, 14-17 ottobre, 1988 c1992 94177002 8870882527
B132.Y6P264130 1976 (ICU JRL Gen) Patañjali Yogasutra of Patañjali : with the commentary of Vyasa 1976 77901067  
B132.Y6V938130 1981 (ICU JRL Gen) Vijñanabhiksu, 16th cent Yogavarttika of Vijñanabhiksu : text, with English translation and critical notes, along with the text and English translation of the Patañjala Yogasutras and Vyasabhasya 1981-1989 82900197  
B2430.A424 S47 1985 (F) Sernin, André Alain : un sage dans la cité, 1868-1951 c1985 85190105 2221013077
B2597 .M8 Müller, Kurt Leben und Werk von Gottfried Wilhelm Leibniz : Eine Chronik 1969 78436839  
B3199.A33 M513 1978 (MAIN) Adorno, Theodor W., 1903-1969 Minima moralia : reflections from damaged life 1978    
B50 +Ac76 10 Sande, Siri Greek and Roman portraits in Norwegian collections 1991]   8876890572
Bb26\+959Da Dworzaczek, Wlodzimierz Genealogia. Tablice 1959 60027503  
BC135 .R47 2000 (P) Restall, Greg, 1969- Introduction to substructural logics 2000 99015946 0415215331
BC141 .I78 1985 v.1 (VPL) Irvine Conference on Probability and Causation (1985 : University of California at Irvine) Causation, chance, and credence c1988 87028857 9027726337
BC6 .H36 2001 (PU vanp)   Handbook of philosophical logic c2001- 2001029838 079237018X
BD331 .L44 1985 (P) Leiber, Justin Can animals and machines be persons? : a dialogue 1985 85021888 0872200027
BD331.L52 (ICU JRL Gen) Leiber, Justin Can animals and machines be persons? : a dialogue 1985 85021888 0872200027
BD418.3 .R69 1997 Rey, Georges Contemporary philosophy of mind 1997 96021571 0631190694
Belgium 26 C8 1985 Belgium Lois coordonnées sur les sociétés commerciales : arrêté royal du 30 novembre 1935 . 1985    
BF173 .F63 (WALT) 9ZAR10D05S01TJ9 Freud, Sigmund, 1856-1939 Problem of lay-analyses 1927 27022733 //r86  
BF175.5.O24 M585 2000 Mitchell, Stephen A., 1946- Relationality : from attachment to intersubjectivity 2000 00033144 0881633224
BF1779.F4 K554 1999 Kingston, Karen Clear your clutter with feng shui c1999 98050645 0767903595
BF241 .F57 1999 (MASTK)   Fleeting memories : cognition of brief visual stimuli c1999 98036547 0262032619
BF311 .I574 2001g International Conference on Cognitive Modeling (4th : 2001: Fairfax, Va.) Proceedings of the 2001 Fourth International Conference on Cognitive Modeling, July 26-28, 2001 George Mason University Fairfax, Virgiania, USA 2001   0805840427
BF311 .S5676 1998 (NNU Bobst)   Similarity and symbols in human thinking c1998 98007439 0262692147
BF353.5.N37 C64 1997 Cohen, Michael J., 1929- Reconnecting with nature : : finding wellness through restoring your bond with the earth 1997 96029597 0963970526
BF51 .R45 1996 (P)   Religion and the clinical practice of psychology c1996 95051499 1557983216
BF575.S75 L5 1991 (P)   Life-span developmental psychology : perspectives on stress and coping 1991 90022087 0805803718
BF611 .C858x 2000 (P)   Cultures of control 2000   9058230120
BF637 .R57 S57 2000 (CSt GREEN STACKS) Slovic, Paul, 1938- Perception of risk 2000 00059305 1853835285
BF639 .G19 Gates, Donald Edson Elmer Gates and the art of mind-using [1971] 74114058 0682469947
BF697.5.S43 H363 1996 (MASTK)   Handbook of self-concept : developmental, social, and clinical considerations c1996 95015681 0471599395
BF719 .I535 2000   Infant development : the essential readings 2000 00026674 0631217460
BF723.G5 S538 1986 (VPL) Wallace, Amy Prodigy c1986 85031547 0525244042
BF724 .S327 1999 (MASTK) Scales, Peter, 1949- Developmental assets : a synthesis of the scientific research on adolescent development c1999 98047379 1574823388
BF77 B87\1998\(LC) Buskist, William Allyn & Bacon guide to master's programs in psychology and counseling psychology c1998   0205274366
BF789.D4 O55 (MED) \610.5\O548   Omega      
BH301.L3 R46 1994   Re-naming the landscape c1994 94000488 082042465X
Biog\M87\6B Bateman, Donald Berkeley Moynihan, surgeon 1940    
BJ1481 .K53\2000 Kingwell, Mark, 1963- In pursuit of happiness : better living from Plato to Prozac 2000 99036083 0609605356
BJ1604.C33 Q46 2000 (NjP f) Quondam, Amedeo, 1943- Questo povero Cortegiano : Castiglione, il libro, la storia c2000   888319456X
BJ1604.C6 S65 1990g (GLX) Soletti, Elisabetta, 1945- Parole ghiacciate, parole liquefatte : il secondo libro del "Cortegiano" c1990 91168222 887694057X
Bj31y\T6\933cc Chack, Paul, 1876-1945 Hoang-Tham, pirate c1933    
BL1032 .E377 1999 (NNU NYU Bobst)   Eastern ways of being religious : an anthology 1999 99033847 0767412257
BL2525 W85\1998 Wuthnow, Robert After heaven : spirituality in America since the 1950s c1998 97045121 0520213963
BL2532.S3 G67 González-Wippler, Migene Santería experience c1982 81013989 0137910797
BL2765\.I5 M33\1997 Madan, T. N Modern myths, locked minds : secularism and fundamentalism in India 1997 97900357 0195640721
BL410 .E8 v.20 (HIS) Roullet, Anne Egyptian and Egyptianizing monuments of imperial Rome 1972 73151259 9004034102
BL48 .B6439\1994 Boyer, Pascal Naturalness of religious ideas : a cognitive theory ofreligion 1994 92037506 0520075595
BL487 .M57 1989 (MAIN)   Miracles c1989 88005121 0024187313
BL53 .P228 1997 (BAKR) Pargament, Kenneth I. (Kenneth Ira), 1950- Psychology of religion and coping : theory, research, practice c1997 97009599 1572302143
BL53 .P8246\1997   Psychology of religion : theoretical approaches 1997 96041128 0813329469
BL580 .S24\1994   Sacred sites, sacred places 1994 93033400 0415096030
BL619.P5 S24 1997   Sacred places, sacred spaces : the geography of pilgrimages c1997 96047392 0938909665
BL685 .R68 1984 (BMAIN) Roux, Jean-Paul, 1925- Religion des Turcs et des Mongols 1984 84171563 2228134309
BL760.V6 M3 ((FTaSU) main,hum) Maule, Quentin F. (Quentin Froebel) Votive religion at Caere: prolegomena 1959 a 59009328  
BL795.P5 D555\1997 Dillon, Matthew, 1963- Pilgrims and pilgrimage in ancient Greece 1997   0415127750
BL80.2 .W66 1996 (MAIN)   World religions : Eastern traditions 1996 96161350 0195407504
BL813.E8L33 1988 (ICU JRL Gen) Labarbera, Jeanne Lee Studies on female Etruscan terracotta votive heads : V-I centuries B.C. 1988    
BL820.P68 C48 1986 Charachidzé, Georges Prométhée, ou, Le Caucase : essai de mythologie contrastive c1986 87144776 2082111660
BL900 .C69 1993 (F) Cowan, Thomas Dale Fire in the head : shamanism and the Celtic spirit c1993 92053909 0062501747
BM525 .A8 (MAIN) Ambelain, Robert Kabbale pratique; introduction à l'étude de la kabbale, mystique et pratique, et à la mise en action de ses traditions et de ses symboles, en vue de la théurgie 1951    
BM535 .B367 1993 (BMAIN)   Begegnungen zwischen Christentum und Judentum in Antike und Mittelalter : Festschrift für Heinz Schreckenberg 1993 93204020 3525542003
BM755.J8 B553 (MAIN) Bloch, Chajim, 1881- Golem [c1925] 29019069  
BM755\S249 A3X\1992\(LC) Scalamonti, John David Ordained to be a Jew : a Catholic priest's conversion to Judaism c1992 92025994 0881254126
BP134.G6 I97 1998a (BAKR) Izutsu, Toshihiko, 1914- God and man in the Koran : semantics of the Koranid Welcanschauung 1964 79082554 0836992628
BP154.B76 2000 (ICU JRL Gen) Brockopp, Jonathan E., 1962- Early Maliki law : Ibn 'Abd al-Hakam and his major Compendium of Jurisprudence 2000 99054416 9004116281
BP43.S38 N38 1985 (GLX) Ndiaye, Mamadou Enseignement arabo-islamique au Sénégal 1985 86968025 9290636777
BP64.A4 S78 1988 Cruise O'Brien, Donal B. (Donal Brian) Charisma and brotherhood in African Islam 1988 88012437 019822723X
BP65.S5M4 (ICU JRL Gen) Marty, Paul, 1882-1938 Études sur l'Islam au Sénégal 1917 19013570  
BQ4012 .L33 1988 (NNU NYU Bobst) BQ4012 .L33 1988 On reserve (NNU NYU Bobst BRES) LaFleur, William R Buddhism : a cultural perspective 1988 87002320 0130847240
BR110 .M43 1999   Measures of religiosity c1999 99010330 089135106X
BR112 .D53 2000 (HIS) Dickson, Gary Religious enthusiasm in the medieval West : revivals, crusades, saints c2000   0860788253
BR1610 .T654 1998 (NNU Bobst)   Toleranz im Mittelalter 1998   3799566457
BR846 .C46 1985 (GLX) Cholvy, Gérard Histoire religieuse de la France contemporaine c1985-c1988 86125953 2708953214
BR846 .C48 1991 Cholvy, Gérard Religion en France de la fin du XVIIIe à nos jours c1991 92113584 2010159586
BR846 .D42 1906a Debidour, Antonin, 1847-1917 Église catholique et l'État sous la troisième république (1870-1906) 1906-09 08011733  
BR877.T74 M37 1984 (GLX) Marangon, Paolo Pensiero ereticale nella Marca Trevigiana e a Venezia, dal 1200 al 1350 c1984 86102028  
BR908\U8 S37\1995 Kaplan, Benjamin J Calvinists and Libertines : confession and community in Utrecht, 1578-1620 1995 95007330 0198202830
BS1485.2 .O4 (LC) (CRO) Ohly, Friedrich, 1914- Hohelied-Studien; Grundzüge einer Geschichte der Hoheliedauslegung des Abendlandes bis um 1200 1958    
BS1555.H453 B7 (DIV) Braverman, Jay, 1937- Jerome's commentary on Daniel : a study of comparative Jewish and Christian interpretations of the Hebrew Bible 1978 7855726//r852 091517006X
BS2825.2 S84\1996 Stefanovic, Ranko Background and meaning of the sealed book of Revelation 5 c1996   1883925134
BS410.5 K566 Kio, Stephen Hre Exodus as a symbol of liberation in the book of the apocalypse 1985    
BT50 R47X\1999   Relationship between epistemology, hermeneutics, biblical theology and contextualization : understanding truth c1999 98043831 0773482172
BT96 .M2313 1993 Maistre, Joseph Marie, comte de, 1753-1821 St. Petersburg dialogues, or, Conversations on the temporal government of Providence 1993   0773509828
BV1360\A8 D86\1991 Dunn, Margaret, 1919- Dauntless bunch : the story of the YWCA in Australia 1991 92201214 0949525200
BV1360\N45 C66\1986\(LC) Coney, Sandra Every girl : a social history of women and the YWCA in Auckland, 1885-1985 c1986 89104583  
BV4529.18 .M67 2001   Mother's advice books 2001 99056943 1840142219
BX1490 P65\1996 (SML)   Political Catholicism in Europe, 1918-1965 1996 95025450 0198203195
BX1530 .A64 1985 (DIV) Arnal, Oscar L., 1941- Ambivalent alliance : the Catholic Church and the Action française, 1899-1939 c1985 84021961 082293812X
BX1530 .G45 1989 (GLX) (BAR) Gibson, Ralph, 1943- Social history of French Catholicism, 1789-1914 1989 88028652 0415016193
BX1550 M66\1996 Monteiro, M. E Geestelijke maagden : leven tussen klooster en wereld in Noord-Nederland gedurende de zeventiende eeuw 1996 96199448 9065505350
BX4052.N7 B76 1996 (PU vanp) Brown, Mary Elizabeth Scalabrinians in North America (1887-1934) 1996 95037420 0934733880
BX4364.C37 J87 1997 (NNU Bobst) Jursich Durán, Mario Hotel Santa Clara, Cartagena de Indias c1997   9589532780
BX4700.F6 H595 2000 House, Adrian Francis of Assisi 2000 00044979 1587680092
BX4705 .M326 1991 (F) María de Jesús, de Ágreda, sor, 1602-1665 Correspondencia con Felipe IV. : religión y razón de estado Instituto de la Mujer, c1991   8470396056
BX5199.N55 E443 (DIV) Edwards, Brian Herbert Through many dangers 1975   0852340605
BX821.H46 (ICU JRL Gen) Hefele, Karl Joseph von, 1809-1893 Conciliengeschichte. Nach den quellen bearb [1873]-1890    
Byzl\244k Sexby, J. J. (John James) Municipal parks, gardens, and open spaces of London: their history and associations 1898 03011521  
CB428 .V3613 1994 Vaneigem, Raoul, 1934- Revolution of everyday life 1994   0946061017
CC135 .M373 1995 (ST) CC135 .M373 1995   Materials issues in art and archaeology IV : symposium held May 16-21, 1994, Cancun, Mexico c1995   1558992529
CC77.H5 C66 1989 (NNU NYU Bobst)   Conflict in the archaeology of living traditions 1989 88021617 0044450214
CC79.5.A5 P76 1992   Problem solving in taphonomy : archaeological and palaeontological studies from Europe, Africa and Oceania c1989   0909611416
CC79.5.P5 P43 2000 Pearsall, Deborah M Paleoethnobotany : a handbook of procedures c2000 99068199 0125480423
CJ355 .S799 1998 (NjP f)   Studies in Greek numismatics in memory of Martin Jessop Price 1998   0907605958
Coll\Biog\M42\1933 Mead, Kate Campbell (Hurd) Mrs. 1867- Medical women of America; a short history of the pioneer medical women of America and of a few of their colleagues in England 1933 34007625  
CT1215 .V55 F77 1996 (CSt GREEN STACKS) Frolov, N. V. (Nikolai Vladimirovich) Vladimirskii rodoslovets 1996-   5893120124
CT354.8\.L46 B4313\1994 Bébel-Gisler, Dany Leonora : the buried story of Guadeloupe 1994 94026127 0813915155
D107 .K45 1993g   Kings and kingship in medieval Europe 1993 gb 94018210 0951308599
D15.M36 A35 Marshall, Samuel Lyman Atwood, 1900-77 Bringing up the rear : a memoir c1979 79014949 0891410848
D16.8 .L86 1995 Lunde, Gregory James Colligation : covering law and colligation : two theories of historical explanation for decision-making applications c1995   0533110327
D16.8 .M386 1998 (NNU Bobst) McCullagh, C. Behan Truth of history 1998 97008185 0415171105
D217 .I6 1994 (F)   Implicit understanding : observing, reporting, and reflecting on the encounters between Europeans and other peoples in the early modern era 1994 94010675 0521452406
D449.2 .I81   Iskhod k Vostoku : predchuvstviia i sversheniia : utverzhdenie evraziitsev 1921    
D731.S792 Z94 Zumwalt, Ken, 1914- Stars and stripes : World War II and the early years c1989 88016314 0890156581
D802.G3 U5\1944 United States. Army Service Forces. Information and Education Division Pocket guide to Germany 1944] 45036548  
D804.18 .H68x 2000 (law) Oversize D804.18 .H68x 2000 + (olin)   Holocaust's ghost : writings on art, politics, law, and education c2000 00340569 0888643586
D805.A8N54 1996 (ICU JRL Gen)   Niemand wollte es getan haben-- : Texte und Bilder zur "Mühlviertler Hasenjagd" c1996 97170516 3900943419
D805.G3 H32 Hart, Kitty I am alive [1962, c1961] 61017186  
D805.G7 C38 Caveeshar, Sardul Singh, 1886- ed Lahore Fort torture camp; being the first hand account of physical and mental torture and persecution of political detenues kept in the Lahore Fort under the Defence of India rules during the war 1946 sa 64026674 /L  
D805.P7 L19\1989 Laks, Szymon, 1901- Music of another world c1989 89016186 0810108410
D805\A8 K36X\1992 Karny, Thomas, 1964- Hatz : Bilder zur Mühlviertler "Hasenjagd" c1992 93101759 3900943125
D810.W7 S57 1988 (H) Shukert, Elfrieda Berthiaume War brides of World War II c1988 87017787 089141309X
DA\375 L36w\1996 Lamont, William M. (William Montgomerie) Puritanism and historical controversy 1996   0773514457
DA228.G8 F7 (NNU Bobst) Friedman, Lee Max, 1871- Robert Grosseteste and the Jews 1934 34031622  
DA47 .M25 (NNU Bobst) MacDonald, James Ramsay, 1866-1937 Foreign policy of the Labour party [1923] 24005817  
DA565.H45P8 (ICU JRL Gen) Porter, Rose Henniker Heaton "Mrs. Adrian Porter. ." Life and letters of Sir John Henniker Heaton bt. 1916 16022605  
DA690 .Y6 H15 1994 Hall, Richard (Richard A.) English Heritage book of Viking age York 1994 95128002 0713470135
DB619 .H36\1983 Hanisch, Ernst, 1940- Nationalsozialistische Herrschaft in der Provinz : Salzburg im Dritten Reich 1983 83206582 3850150011
DB923.7.S92 E67x\1987 Epstein, Irene Raab, 1925- Gyula Szekfu : a study in the political basis of Hungarian historiography 1987 87025858 0824080246
DB947 .L57 1996 Litván, György Októberek üzenete : válogatott történeti írások 1996 97127092 9633791561
DC\354 .A34w\1995   Affaire Dreyfus et l'opinion publique, en France et à l'étranger [1995]   2868471609
DC158.8 .W34 1997 (NNU Bobst) Wahnich, Sophie Impossible citoyen : l'étranger dans le discours de la Révolution française c1997 97170303 2226092358
DC33.3 .K44 (MAIN) Kelley, Donald R Beginning of ideology : consciousness and society in the French Reformation 1981 80041237 0521235049
DD125 .J34   Jahrbuch der Oswald von Wolkenstein Gesellschaft [198?- sc 82007314  
DD238 H44\1995 Herbert, Ulrich, 1951- Arbeit, Volkstum, Weltanschauung : über Fremde und Deutsche im 20. Jahrhundert 1995   3596126487
DD256.5 .T48 Tenenbaum, Joseph, 1887- Race and Reich : the story of an epoch [c1956] 56000170  
DD257 .S45\1971 Settel, Arthur This is Germany 1971, c1950 70156715  
DD257 .U56x\1947 United States. Army Civil Affairs School (Fort Gordon, Ga.) Public safety 1947    
DD76 .B73 Brickner, Richard Max, 1896- Is Germany incurable? 1943 43006272  
DD89 .D428 2001 (NNU NYU Bobst)   Deutsche Erinnerungsorte c2001   3406472222
DF225 .L39 1993 (LC) (CLA) Lazenby, J. F. (John Francis) Defence of Greece, 490-479 B.C. 1993   0856685917
DF261 .C65 A6 (CSt ART STACKS) Merker, Gloria S., 1936- Sanctuary of Demeter and Kore : terracotta figurines of the Classical, Hellenistic, and Roman periods 2000 99087774 0876611846
DF287.A35 A5 v.10 Lang, Mabel L., 1917- Weights, measures, and tokens 1964 76355553  
DG221 .I87 ((FTaSU) main) British Museum Classical Colloquium (6th : 1982 : London, England) Italian Iron age artefacts in the British Museum : papers of the Sixth British Museum Classical Colloquium c1986   0714112747
DG223.7.M55 C678 1987 + (HISOV)   Corpus speculorum Etruscorum. U.S.A 1987-<1997 > 86031135 0813803632
DG445 .F19 (VPL)   Famiglia e la vita quotidiana in Europa dal '400 al '600 : fonti e problemi ; atti del convegno internazionale, Milano, 1-4 dicembre, 1983 1986    
DG457\S45 C37X\1997 Carter, Donald Martin, 1955- States of grace : Senegalese in Italy and the new European immigration 1997 97025951 0816625425
DG77 .R677 1978 Antikenmuseum (Berlin, Germany) Römisches im Antikenmuseum 1979    
DK\686\.9 .G38\1993z Gaume, Myriam Invités de la Terre : Arménie, Karabagh, 1988-1992 c1993 93225909 2020133849
DK266.45 .A34\1989 Adelman, Jonathan R Dynamics of Soviet foreign policy c1989 88024690 0060401672
DK269 .P65 1999g   Politicheskaia istoriia russkoi emigratsii : 1920-1940 gg. : dokumenty i materialy 1999   5691003054
DK32 .E8   Evraziiskii vremennik 1923-27 48034733  
DK511 .V6 V67 1995 (CSt GREEN STACKS)   Voroninskie chteniia-94 : materialy oblastnoi kraevedcheskoi konferentsii / [redaktsionnyi sovet V.S. Buzykova ... et al. ; ssostavitel' V.G. Tolkunova] 1995    
Doc US D 5.415:C 73 Snyder, Frank M Command and control : the literature and commentaries [1993]    
Downtown N6512 .W495 1981 Box Non-circulating (NNU NYU Bobst SpecCol)   1981 biennial exhibition c1981   0874270324
DP270 .D57 2000 (NNU NYU Bobst)   Disremembering the dictatorship : the politics of memory in the Spanish transition to democracy 2000   9042013524
DR701.M4 B7 1971 (MUSM) Brailsford, Henry Noel, 1873-1958 Macedonia; its races and their future 1971 78135796 0405027389
DS 135 .G33 S5 (LEE) Sharf, Andrew British press and Jews under Nazi rule 1964    
DS\479\.1 .C435\1968 Chakravarty, Shyamsundar, d. 1932 Through solitude and sorrow 1968 98128216  
DS135.E8 V56 1999 (SAPH) DS135.E8 V56 1999 Vishniac, Roman, 1897- Children of a vanished world 1999 99027866 0520221877
DS32.9.F72 P377 1999 (ech) Singaravélou, Pierre Ecole française d'Extrême-Orient, ou, L'institution des marges, 1898-1956 : essai d'histoire sociale et politique de la science coloniale c1999   2738481558
DS432.K192 B59 1997 Boal, Barbara M Human sacrifice and religious change, the Kondhs 1997 97906958 8121003628
DS432.M267 G74 1991 Grigson, W. V. (Wilfrid Vernon), 1896- Maria Gonds of Bastar 1991   0195628551
DS434.W55 (ICU JRL Gen)   Who is who; or, Family-history & biographies of Indian princes, nobles & notables 1951-    
DS450\.N3 S58\1994 Singh, Shiva Bahadur, 1956- Indo-Nepalese relations : discord and harmony 1994 94900810 8185694060
DS481.D385 A33 1979 (MAN) Desai, Morarji Ranchodji, 1896- Story of my life 1979   0080235662
DS481.N21 A4\1977 Narain, Jai Prakash J.P's jail life : a collection of personal letters 1977 77904264  
DS481.S49 A3x\1991 Sher Jung, 1910- Prison days : recollections and reflections 1991 91904267 8170186307
DS485.B31B47 (ICU JRL Gen) Benett, W. C. (William Charles) Report on the family history of the chief clans of the Roy Bareilly district 1870    
DS485\.B38 S86\1997 Sundar, Nandini Subalterns and sovereigns : an anthropological history of Bastar, 1854-1996 1997 97906439 0195641167
DS508 .V41 Vedel, Émile Lumières d'Orient 1901    
DS508\.E82 Estray, Jean d' Pastels d'Asie [19-?]    
DS531 .C76 (ech,anx)   Conférences publiques sur l'Indo-chine faites à l'École coloniale      
DS537 .D24 Daurelle, R Du Trung Ky au pays des hommes bleus 1935]    
DS550 .G27 Gaultier, Marcel Tragédie indochinoise 1947    
DS557.A5 J12 Jacnal, Jean Rêves d'Annam 1913    
DS557.A5 R54 Ricquebourg, Jean Terre du dragon 1907 20013228  
DS557.C2 T52 Thouvenot, Maurice Idylle au pays Khmer; roman de moeurs cambodgiennes [1913]    
DS557.T7 L92 Lubanski, Jules Clément Ladislas, 1854-1906 Tonkinades [1902]    
DS557.T7\J95 Jung, Eugène Vie européenne au Tonkin : roman [1901]    
DS565 .W88 Wood, William Alfred Rae, 1878- Land of smiles 1935    
DS63.2.E8 R68 1986 ((FTaSU) main) Rotter, Ekkehart Abendland und Sarazenen : das okzidentale Araberbild und seine Entstehung im Frühmittelalter 1986   3110098806
DS688.M2 V57 2000 Vitug, Marites Dañguilan Under the crescent moon : rebellion in Mindanao 2000   9719167971
DT509.8 .Y44 1995 Yeebo, Zaya, 1954- State of fear in paradise : the military coup in the Gambia and its implications for democracy 1995    
DT549.4 .M27 1993 (PU vanp) Maranz, David E Peace is everything : world view of Muslims in the Senegambia 1993 92083905 0883128160
E 184 .A1 E847x 2000 (LEE) Yang, Philip Q Ethnic studies : issues and approaches c2000 99047239 0791444791
E\184\.G3 D74x\1998 Domentat, Tamara, 1959- "Hallo Fräulein" : deutsche Frauen und amerikanische Soldaten 1998   335102469X
E\185\.97\.K5 P25x\1998 Pappas, Theodore Plagiarism and the culture war : the writings of Martin Luther King, Jr., and other prominent Americans 1998 98072137 0873190459
E\98\.M8 E24\1994 Echo-Hawk, Roger C Battlefields and burial grounds : the Indian struggle to protect ancestral graves in the United States c1994 92039893 /AC/r94 0822526638
E169.1 .K6 (NNU NYU Bobst) E169.1 .K6 Non-circulating (NHi NYHS NYHistSoc) Knoles, George Harmon Jazz age revisited : British criticism of American civilization during the 1920's / George Harmon Knoles 1955 55010016  
E169.1 .L819 1990   Looking inward looking outward : from the 1930s through the 1940s 1990 93111084 9062569579
E184.D6 A66 1999 (MASTK) Aponte, Sarah Dominican migration to the United States, 1970-1997 : an annotated bibliography c1999 00272508  
E184.I6 D56\1983 (IHRCC) E184\.I6 D56\1983 Diner, Hasia R Erin's daughters in America : Irish immigrant women in the nineteenth century c1983 83000183 0801828724
E184.J5 B73 1986 (MAIN) Brenner, Lenni, 1937- Jews in America today c1986 86023028 0818403799
E184.S55 G53 1988 Gibson, Margaret A Accommodation without assimilation : Sikh immigrants in an American high school 1988 87047861 0801421225
E185.61 +R25\12\(LC) Hooker, Robert W Displacement of Black teachers in the eleven Southern states 1970    
E185.86 .W4885 2001 Williams, Melvin D., 1933- Black experience in middle-class America : social hierarchy and behavioral biology c2001 00064557 0773476598
E302 .L3 (MAN) Laurens, Henry, 1724-1792 Papers of Henry Laurens 1968- 67029381 0872491285
E441.S24 (ICU JRL Gen) Sargent, F. W. (Fitzwilliam), 1820-1889 England, the United States, and the Southern Confederacy 1863 a 11002661  
E476.93 .T78 1991 (NNU Bobst) Trudeau, Noah Andre, 1949- Last citadel : Petersburg, Virginia, June 1864-April 1865 c1991 91021410 0316853275
E59.P89G55 1997 (ICU JRL Gen)   Indiani d'America e l'Italia : atti del convegno di studi, Torino, 14-15 ottobre 1996 c1997 97200661 8876942572
E61 .B67 (F) Bonnichsen, Robson Pleistocene bone technology in the Beringian Refugium 1979 80469443  
E661 .M23 1993   Major problems in the Gilded Age and the Progressive Era : documents and essays c1993 92070798 0669216801
E748.D25 B96 Burlingame, Roger, 1889-1967 Don't let them scare you : the life and times of Elmer Davis [1961] 61008669  
E78.I3 C62 1986 \quarto\ Conner, Michael D. (Michael David), 1952- Cypress Land : a late archaic/early woodland site in the lower Illinois River floodplain 1986 86021567 0942118235
E78.I3 E27 1992 (BAKR)   Early Woodland occupations at the Ambrose Flick site in the Nothern Sny Bottom of West-Central Illinois 1992 92016100 0942118332
E78.I3 W66 1986 (BMAIN)   Woodland period occupations of the Napoleon Hollow site in the lower Illinois valley 1986 86029875 0942118251
E78.M6 K43 Keene, Arthur S Prehistoric foraging in a temperate forest : a linear programming model 1981 81012727 0124030203
E840 .H592 1996 (CSt GREEN STACKS) Holsti, Ole R Public opinion and American foreign policy c1996 96010151 0472096192
E842.9 .S36 1996g Schotz, E. Martin History will not absolve us : Orwellian control, public denial, and the murder of President Kennedy 1996 96077807 0965381404
E97.6 .C2\P89\1964 Pratt, Richard Henry, 1840-1924 Battlefield and classroom : four decades with the American Indian, 1867-1904 1964    
E98.R3 R44 1990 (MAIN)   Religion in native North America c1990 89078337 0893011355
E98.R3 S95\1999 Swan, Daniel C Peyote religious art : symbols of faith and belief c1999 98037426 1578060966
E98\.M34 N37\1997   Native Americans and archaeologists : stepping stones to common ground c1997 97004593 0761989005
f NA5551.R36V8 (ICU JRL Gen)   Cathédrale de Reims, architecture et sculpture [1919]    
F\h415 Vijnana Bhikshu, fl. 1550 English translation with sanskrit text of the Yogasara-sangraha 1894    
F1234 .B315 1993 Basurto, Jorge Vivencias femeninas de la Revolución c1993 94123117 9688059455
F1386.3 +I58 1974 (LC) (S)   Investigaciones sobre la historia de la Ciudad de México 1974- 82178576//r84  
F1408 .L3865 1998 (NNU Bobst)   Latin America : perspectives on a region 1998 98006494 0841913633
F157\C4 H29\1990\(LC) Harper, Douglas R., 1960- "If thee must fight" : a Civil War history of Chester County, Pennsylvania 1990 90047580 0929706056
F1621.I37 (ICU JRL Gen) Incháustegui Cabral, Joaquín Marion Gran expedicion inglesa ; contra las Antillas Mayores 1958-    
F1621.S877 1990 (ICU JRL Gen) Sutton, Paul Jamaica campaign : the Cromwellian West Indies campaign, 1654-55 1990 gb 93017358 094652579X
F1621.T24 (ICU JRL Gen) Taylor, S. A. G. (Stanley Arthur Goodwin), 1894- Western design: an account of Cromwell's expedition to the Caribbean 1969 79471711//r82 0901814024
F1887 .D35 1985 Dennis, Colin Road not taken : memoirs of a reluctant guerilla c1985    
F1935 .V436 1988 (F) Vega, Bernardo, 1938- Más imágenes del ayer 1981    
F2096 .L29 1991 (BMAIN) Lawaetz, Erik J., 1913- St. Croix : 500 years pre-Columbus to 1990 1991 92160340 8774682989
F2291.C3 A773 Arrazola, Roberto Secretos de la historia de Cartagena [1967- 68086093  
F2822 .R44 1979 Relación de los cristianos salvados del cautiverio por la División Izquierda del Ejército Expedicionario contra los bárbaros, al mando del señor brigadier general D. Juan Manuel de Rosas Juan Manuel de Rosas y la redención de cautivos en su campaña al desierto (1833-1834) 1979 81213528  
F2822 .V56 1982 (MAIN) Vi~nas, David Indios, ejército y frontera 1982 84185641 9682311756
F2847 .A68 1977 Alsina, Adolfo, 1829-1877 Nueva línea de fronteras : memoria especial del Ministerio de Guerra y Marina, año 1877 1977 80466714 //r832  
F311 .D47 1998 (NNU Bobst) Derr, Mark Some kind of paradise : a chronicle of man and the land in Florida c1998 98008860 0813016290
F615.J3 R44 1994 (PU vanp)   Reflections : memoirs of Japanese American women in Minnesota 1994 94065105 //r95 1879600226
F630.M45 S93\1995 Swander, Mary Out of this world : a woman's life among the Amish 1995 95010002 0670858080
Fd15\B464\93 Patañjali Yoga aphorisms of Patanjali 1883    
FICHE (CRLL) Adamov, Arthur Ping-pong. Microform 1955    
FICHERH19399 (CRLL)   Obzor dieistvii Departamenta sel'skago khoziaistva i ocherk sostoianiia glavnykh otraslei sel'skoi promyshlennosti v Rossii v techenie 10 liet s 1844 po 1854 god [microform] 1855    
Film 12444 (ech) Kramer, Paul A. (Paul Alexander), 1968- Pragmatic empire [microform] : U.S. anthropology and colonial politics in the occupied Philippines, 1898-1916 1998    
Film 2889 ((FTaSU) main,micr) Cheshier, Cavit Calvin, 1929- Professional sanctions by the National Education Association and its affiliates 1965    
Film An Su24 (MIC)   Süddeutsche Zeitung [microform] 1945-    
Film B12065 (MIC) (NEG) Film N11096 Duguit, Léon, 1859-1928 Traité de droit constitutionnel [microform] 1921-25    
Film B4323 (MIC) Paulson, David War and revolution in North China [microform] : the Shandong base area, 1937-1945 c1982    
Film S1608 (MIC)   Journal of the Institute of Jamaica [microform] 1894-1899    
Film\4060 Miner, Noel Ray, 1944- Chekiang: the Nationalist's effort in agrarian reform and construction, 1927-1937 1973    
Film\An\In8 Daily inter ocean (Chicago, Ill.) Daily inter ocean [microform] 1879-1902    
Film\An\In8 Daily inter ocean (Chicago, Ill.) Daily inter ocean [microform] 1879-1902    
Film\An\N4275   New York post [microform]      
Film\D10844 Brown, Stephen C Dual interval space in twentieth-century music [microform] 1999    
Film\N3463 (ECHMT) Film\3463 Leuba, Jeanne, 1882- Brève lumière [microform] [1930]    
fND3161.P3M56 1999 (ICU JRL Gen)   Miniatura a Padova : dal medioevo al Settecento [1999]   8882900452
Fza9\B77 Brinton, Daniel Garrison, 1837-1899 Aboriginal American authors and their productions; especially those in the native languages. A chapter in the history of literature 1883 15000759  
G1201\.S1 U6x\1971 National Archives (U.S.) Geographical exploration and topographic mapping /by United States Government, 1777-1951; catalog 1971,c1952 a 52009679  
G161 .H2, ser.2, no.56 ((FTaSU) main) Harlow, Vincent T. (Vincent Todd), 1898-1961 Colonising expeditions to the West Indies and Guiana, 1623-1667 1925 25020379  
G70.212 .G489 2001 (CSt EARTH-SCI STACKS)   Getting to know ArcGIS desktop : basics of ArcView, ArcEditor, and ArcInfo 2001 2001003387 1879102897
G96 .G61 Goetzmann, William H Exploration and early American culture 1988, c1989   0944026079
GB1197.7 .H335\1995 Haitjema, H. M. (Henk M.) Analytic element modeling of groundwater flow c1995 95016533 0123165504
GB400.4 .T37 2000   Terrain analysis : principles and applications c2000 99089635 0471321885
GB406.Q3 (BRAN)   Quantitative geomorphology: some aspects and applications [1971?]    
GE180 .E36 1997   Economic analyses at EPA : assessing regulatory impact c1997 97014606 0915707837
GE45.S73 M55 2001 (PU vanp) Millard, Steven P Environmental statistics with S-Plus c2001 00058565 0849371686
GF3 .H86 1993 (BMAIN)   Humans as components of ecosystems : the ecology of subtle human effects and populated areas c1993 93010444 0387940626
GF41 .R45 1998 (PU vanp)   Remaking reality : nature at the millenium 1998 97035301 0415144930
GF54.5 .N37 1997   Nature is culture : indigenous knowledge and socio-cultural aspects of trees and forests in non-European cultures 1997 98145195 1853394106
GN2.A27 v.58 pt.1, etc. (ICU JRL Gen) Thomas, David Hurst Archaeology of Monitor Valley 1983- 83147762  
GN33.6 .W35 1992 (NNU NYU Bobst) GN33.6 .W35 1992 Non-circulating (NNU NYU Bobst Tamiment) GN33.6 .W35 1992 (NNNS NSSR NewSchool) Wakin, Eric Anthropology goes to war : professional ethics & counterinsurgency in Thailand c1992 91074029  
GN397.7.U6 U55 2000 (NNU NYU Bobst)   Unity of theory and practice in anthropology : rebuilding a fractured synthesis c2000 99088676 0913167932
GN42 .K89 1997 (NNU Bobst) Kuznar, Lawrence A Reclaiming a scientific anthropology c1997 96035699 0761991131
GN491 H54X\2000(LC)   Hierarchies in action : Cui bono? c2000 98071044 0881040843
GN495.6.S835 1998 (ICU JRL Gen) Stallaert, Christiane Etnogénesis y etnicidad en España : una aproximación histórico-antropológica al casticismo c1998   8492233575
GN502 .A473 1991 (F)   Alterity, identity, image : selves and others in society and scholarship 1991   9051832516
GN645 .E546 1997 (NjP f)   Endogenous knowledge : research trails 1997 98172253 2869780400
GR001 1981 .B859 (STOR) Microfilm\P38:1981 Briscoe, Virginia Wolf Bryn Mawr College traditions, women's rituals as expressive behavior 1981    
GR110.M77 P57   Pissing in the snow and other Ozark folktales c1976 76018181 0252006186
GR462 R67X\1994\(LC) Ross, Sonja Brigitte Vagina dentata in Mythos und Erzählung : Transkulturalität, Bedeutungsvielfalt und kontextuelle Einbindung eines Mythenmotivs 1994   3860970453
GR505 .M65 1995 Molyneaux, Brian Sacred earth c1995 94072920 0316903035
GR550 G66X\1991\(LC)   Good people : new fairylore essays 1991 91008853 082407100X
GR98 .R6515 (SY) Rozenberg, Yehudah Yudl, 1865-1935 Golem mi-Prag u-ma'asim nifla'im aherim c1991   9653425668
GT2085 .F56 1990 (F) Finlayson, Iain Denim : an American legend c1990 90033178 0671723685
GT3242 .V47 1999 Verdery, Katherine Political lives of dead bodies : reburial and postsocialist change c1999 98045114 0231112300
GV199.42\N66 D4X\1988\(LC) De Hart, Allen North Carolina hiking trails c1988 87031848 0910146691
GV706.5 .C63 2001 (NNU NYU Bobst) Coakley, Jay J Sport in society : issues & controversies c2001 00060920 0072328916
GV788.5 .S45 1992 (P) Seidman, David Essential sea kayaker : a complete course for the open-water paddler c1992 91015988 0877423059
GV863.29.A1 D657 1999 (P) Ruck, Rob, 1950- Tropic of baseball : baseball in the Dominican Republic [1999] 98045479 0803289782
GV909 .D36 1994 Daniele, Rico Bocce : : a sport for everyone c1994    
GV909.M38 1976 (MAN) Maxwell, Harvey C American lawn bowler's guide : an instruction manual and guide to the game of bowls or "bowling on the green" in the U.S.A. 1976    
GV928.W47 L53 1995 (P)   Liberation cricket : West Indies cricket culture c1995 94011595 071904314X
H61 .G555 1992 Glesne, Corrine Becoming qualitative researchers : an introduction c1992 91022604 0801302951
H62 .H725\1996 Hult, Christine A Researching and writing in the social sciences c1996 95023156 0205168418
HA29 .M67 2000 (ICU Eck Eck)   Modeling longitudinal and multilevel data : practical issues, applied approaches, and specific examples 2000 99052417 0805830545
HA29 .W525\2001 Williams, Frederick, 1933- Reasoning with statistics : how to read quantitative research c2001 00107028 0155068156
HA31.2 .L64 1999 (CSt MATH-CS STACKS) Lohr, Sharon L., 1960- Sampling : design and analysis c1999 98044566 0534353614
HA31.2 .L64 1999 (P) Lohr, Sharon L., 1960- Sampling : design and analysis c1999 98044566 0534353614
HB137 .P645 1995 Poirier, Dale J Intermediate statistics and econometrics : a comparative approach c1995 94028184 0262161494
HB139 .N48 1995   New directions in spatial econometrics c1995 95031116 3540600205
HC 79 .T4 H67 2001 (LEE) Hornborg, Alf Power of the machine : global inequalities of economy, technology, and environment c2001 2001035413 0759100667
HC103 .N24 Nash, Gerald D Issues in American economic history; selected readings [c1964] 63022520  
HC1055 .M68 1997 Moser, Gary G. (Gary Gene), 1958- Nigeria : experience with structural adjustment 1997 97001966 1557756309
HC106.3 .C714 v.58 (P)   Economics of new goods 1997 96027822 0226074153
HC427.92 .C4623w\1997 (URIS) HC\427\.92 .C4623x\1997   China 2020 : development challenges in the new century c1997 97207683 0821340425
HC501 .S48 no.11 Coulon, Christian Marabout et le Prince : Islam et pouvoir au Sénégal 1981 82111402 2233001001
HC79.P6 S67\1995   Social exclusion : rhetoric reality responses 1995   9290145374
HD1865.B8 H84 1993 (NNU Bobst)   Huellas en la tierra : indios, agricultores y hacendados en la pampa bonaerense 1993 94169136 9506580294
HD2346.I52 V593 1991 Benjamin, Solomon J., 1960- Jobs, land, and urban development : the economic success of small manufacturers in East Delhi, India c1991 90028671 1558441107
HD260.F5670 1990 (ICU DLL Law) Fischel, William A Do growth controls matter? : a review of empirical evidence on the effectiveness and efficiency of local government land use regulation 1990, c1989 89014414 1558440879
HD2899 .B32x\1997 Banerjee, Swapna Spatial dynamics of international capital : a study of multinational corporations in India 1997 98900328 8125012893
HD30.4 M365\1997\(LC)   Management learning : integrating perspectives in theory and practice 1997 97068756 0803976437
HD31 .F273 1996 (P) Farson, Richard Evans, 1926- Management of the absurd : paradoxes in leadership c1996 95025346 0684800802
HD3616.U46 W455 (MEYER) HD3616.U46 W455 Weinstein, Michael M Recovery and redistribution under the NIRA 1980 80016999 044486007X
HD4815 .I55 (BAR) HD4815 .I55 Industrial Relations Research Association Proceedings of the ... annual meeting c1949- 50013564 //r82  
HD53 .C66 1998 (P) Cook, Peter, 1958- Best practice creativity c1998 98006783 0566080273
HD5724 .B66 1998 (PU vpref) Bond, James T 1997 national study of the changing workforce c1998   1888324090
HD6073.M772 U543 (P) Conover, Carole Cover girls : the story of Harry Conover c1978 78015686 0131883003
HD6101 .M84 (MAIN)   Mujer y el movimiento obrero mexicano en el siglo XIX : antología de la prensa obrera 1975 75514952  
HD6119 .W34 (F) Wainerman, Catalina Trabajo de la mujer en la Argentina : un análisis preliminar de las ideas dominantes en las primeras décadas del siglo XX 1979 79120394  
HD62.4 .I334 1999   IEBM handbook of international business c1999   1861522169
HD62.6 N36X\1999\(LC) Nanus, Burt Leaders who make a difference : essential strategies for meeting the nonprofit challenge c1999 99006757 0787946656
HD645 .J95 Jung, Eugène Histoire d'un colon [1903?]    
HD6971 .E554 1995   Employment relations in a changing world economy c1995 95022499 0262121913
HD7105.35.U6 L374 1932 Latimer, Murray Webb Trade union pension systems, and other superannuation and permanent and total disability benefits in the United States and Canada Industrial Relations Counselors 1932 32033557  
HD8005.2 .F7\S58 1989 Siwek-Pouydesseau, Jeanne Syndicalisme des fonctionnaires jusqu'à la guerre froide : 1848-1948 c1989 90101750 2859393420
HD8005.2.F7B530 (ICU JRL Gen) Bidouze, René Fonctionnaires, sujets ou citoyens? : le syndicalisme, des origines à la scission de 1947-1948 1979 80114565 2209053595
HD8039.M77 B43 1999 (MAIN) Bailey, David, 1938- Models close-up 1999   0789302551
HD8376.5 .N46 1994 ((FTaSU) main)   New frontiers in European industrial relations 1994 94007344 0631186069
HD8380.5 .C48 1998 (PU lipp)   Changing industrial relations in Europe c1998 97024520 0631205500
HD8428.W42 (ICU JRL Gen) Weill, Georges, 1865-1944 Histoire du mouvement social en France, 1852-1902 1904 08012162  
HD9560.6 .Y47\1993 Yergin, Daniel Prize : the epic quest for oil, money, and power 1993, c1992 90047575 0671799320
HdCpy (CRLP)   Weser Kurier 1945- sn 90048395#  
HdCpy (CRLS)   Talking machine world      
HE\8699\.F7 M48\1994 Méadel, Cécile Histoire de la radio des années trente : du sans-filiste à l'auditeur c1994   2717826262
HE2781.N7 C66 Condit, Carl W Port of New York c1980-1981 79016850 //r82 0226114600
HE305 .F67 1998 F (CSt GREEN STACKS)   Four world cities transport study c1998   011702645X
HE5614 .I564 1999 (PU-L)   International handbook of road traffic accidents and psychological trauma : current understanding, treatment, and law 1999 99051934 008042760X
HE5614 .I564 1999 (PU-L)   International handbook of road traffic accidents and psychological trauma : current understanding, treatment, and law c1999 99051934 008042760X
HE6935 .E4 (P) Ellis, Kenneth Post Office in the eighteenth century; a study in administrative history 1958 58000773  
HF1134 .S77 R63 1994 Robinson, Peter, 1957- Snapshots from hell : the making of an MBA c1994 93047682 0446517860
HF1613 .A27 1997 Abrahamsson, Hans, 1949- Seizing the opportunity : power and powerlessness in a changing world order : the case of Mozambique [1997] 98151284 9187380404
HF375 .R44 1995 (CSt GREEN STACKS) Reden, Sitta von Exchange in Ancient Greece 1995 96138054 0715626000
HF5415.157 .P764\1996   Product warranty handbook c1996 95040479 0824789555
Hfs\ve100 Vedel, Emile, b. 1858 île d'épouvante .. [1903]    
HG101 .G65 2001 (NjP f) Gollier, Christian Economics of risk and time c2001 2001030213 0262072157
HG101 .P68 2000 (NjP f) Bouchaud, Jean-Philippe Theory of financial risks : from statistical physics to risk management 2000 00020325 0521782325
HG4515.15 .N64x 2001 (jgsm) Nofsinger, John R Investment madness : how psychology affects your investing-- and what to do about it c2001 2001024614 0130422002
HG4515.2 .B384 2001 (PU vanp) Bauwens, Luc, 1952- Econometric modelling of stock market intraday activity c2001 2001038183 079237424X
HG4515.2 .B384\2001 Bauwens, Luc, 1952- Econometric modelling of stock market intraday activity c2001 2001038183 079237424X
HM101 .M62\1992   Modernity and its futures 1992 gb 92039522 0745609651
HM131 .K444 1996 Kelly, Caroline Social psychology of collective action : identity, injustice and gender 1996   0748405100
HM131 .S437\1993 Shaffer, Carolyn, 1943- Creating community anywhere : finding support and connection in a fragmented world c1993 93014895 0874777461
HM131 S53X\1993\(LC) Shaffer, Carolyn, 1943- Creating community anywhere : finding support and connection in a fragmented world c1993 93014895 0874777461
HM291 .A885 1983 (SW)   Attribution theory : social and functional extensions 1983 83217748 0631132570
HM55.M332130 (ICU Harp Harp) Mauss, Marcel, 1872-1950 Sociology and psychology : essays 1979 78041292 0710088779
HM851 .F674 1999 Ford, Aníbal, 1934- Marca de la bestia : identificación, desigualdades e infoentretenimiento en la sociedad contemporánea 1999 00271067 9879334167
HQ\1206 .S47x\1999 Sheindlin, Judy, 1950- Beauty fades, dumb is forever : the making of a happy woman 1999 98051364 0060192704
HQ1154 .M68 (F) Moreau de Justo, Alicia Mujer en la democracia [1945] 46023419  
HQ1181 .D65 D63 2000 (CSt GREEN STACKS) Cocco-DeFilippis, Daisy, 1949- Documents of dissidence: selected writings of Dominican women c2000 00364925 0967674123
HQ1190 W48X\1991\(LC) Whitford, Margaret Luce Irigaray : philosophy in the feminine c1991 90040947 0415059682
HQ1236.G464 1999 (ICU JRL Gen)   Género y ciudadanía : revisiones desde el ámbito privado 1999   8474777283
HQ1402 .C5 1894a f (ART) Chicago (Ill.). World's Columbian Exposition, 1893. Board of Lady Managers Addresses and reports of Mrs. Potter Palmer, president of the Board of lady managers, World's Columbian commission 1894 34003472  
HQ1460.5 .J8 1934 (F) Justo, Sara Porque-- 1934    
HQ1533 .F6 1921   Mujer : encuesta feminista argentina 1921 85196106  
HQ1600.3 .N65 1989 Nolan, Janet Ourselves alone : women's emigration from Ireland, 1885-1920 c1989 89035145 0813116848
HQ161.A5 T38 1999 (PU vanp) Tchak, Sami Prostitution à Cuba : communisme, ruses et débrouille c1999 00299088 273848185X
HQ1619.5 .Z46 1999 (CSt GREEN STACKS) Zimmermann, Susan Bessere Hälfte? : Frauenbewegungen und Frauenbestrebungen im Ungarn der Habsburgermonarchie 1848 bis 1918 c1999   3853711537
HQ18 .U5 S475 1994   Sex in America : a definitive survey c1994 94018258 0316075248
HQ196.P3C7 (ICU JRL Gen) Coffignon, A., 1861- Corruption à Paris: le demi-monde, les souteneurs, la police des moeurs, brasseries de femmes, filles galantes, Saint-Lazare, le chantage, etc., etc [1888]    
HQ200\F73 K74X\1988\(LC) Kreuzer, Margot D. (Domenika) Prostitution : eine sozialgeschichtliche Untersuchung in Frankfurt a.M. : von der Syphilis bis AIDS 1988 89219959 3892720320
HQ472\.U6 K45x\2000 \Quarto\ Kelly, Eric D "Everything you always wanted to know about regulating sex businesses" c2000   1884829481
HQ759.48 .K45\1994 Keller, Kathryn Mothers and work in popular American magazines c1994 93037508 031328864X
HQ76.2.U5 B55 1997   Letters to our children : lesbian and gay adults speak to the new generation c1997 96036213 /AC 0531113221
HQ76.25 .G35 2000 (CSt GREEN STACKS)   Gai saber : introducció als estudis gais i lèsbics 2000   8495317133
HQ796 .F589x 1999 (P) FitzSimmons, Ellen Teach me : an ethnography of adolescent learning : cultural shopping and student lore in urban America c1999   1573094005
HQ799.G3 R94 (H) \f\ Ruetz, Michael "Ihr müsst diesen Typen nur ins Gesicht sehen" (Klaus Schütz, SPD) : APO Berlin, 1966-1969 1980    
HT1096 .H34 1989g (LEH) Hall, Douglas In miserable slavery : Thomas Thistlewood in Jamaica 1750-86 1989 gb 88033936 0333480309
HT165.5 .F74 1999 (CSt GREEN STACKS) Frey, Hildebrand W., 1940- Designing the city : towards a more sustainable form 1999 98031105 0419221107
HT391 .C483 1998 (PU vanp) Cicin-Sain, Biliana Integrated coastal and ocean management : concepts and practices c1998 98012593 1559636033
HT395.E8 C66 1995   Convergence and divergence among European regions c1995 gb 96009119 0850861659
HV11 .N487 1995   New foundations for scientific social and behavioral research : the heuristic paradigm c1995 94000142 0024219010
HV6248.G38 G52 (LC) (S) Giancana, Antoinette Mafia princess : growing up in Sam Giancana's family 1984 83063294 0688026206
HV6433.E85 W47 1993 (BAKR)   Western responses to terrorism 1993 93009572 0714640905
HV6453.I83 L66 1998 (PU vanp) Longrigg, Clare Mafia women 1998 gb 98050116 0099591715
HV7911.N37 A34 1981 Nath, Trilok Forty years of Indian police 1981, c1980 81903198  
HV8077.5\C6 F67X\1999\(LC)   Forensic examination of fibres c1999 99462667 0748408169
HV85 .A4844 (VPL) United States. Bureau of Labor Statistics Salaries and working conditions of social welfare manpower in 1960. A survey conducted [1961?] 61003823  
HV9471 .D87 1994 Durham, Alexis M Crisis and reform : current issues in American punishment c1994 93079051 0316197106
HV9793 .N394 (LEH) Nayar, Kuldip, 1923- In jail c1978 78904940 0706906470
HX741.98.A3 E9 ((FTaSU) main,soc)   Evraziistvo i kommunizm n.d.]    
I 29.2:T 71/6 Parker, Patricia, 1943- Keepers of the treasures : protecting historic properties and cultural traditions on Indian lands : a report on tribal preservation funding needs submitted to Congress by the National Park Service, United States Department of the Interior [1990]    
In Process (PU fine) ND688.5.F87 R8717 2000 (PU fine)   Russian futurism and David Burliuk, "The father of Russian Futurism" c2000   5933320285
J565\+935G Giglioli, G. Q. (Giulio Quirino), b. 1886 Arte etrvsca 1935 38014223  
J681\A8\+929B (SML) J681\A8\+928B Burliuk, David, 1882-1967 Russkie khudozhniki v Amerike : zhivopis', skul'ptura, teatr, muzyka i prikladnye iskusstva ; materialy po istorii russkogo iskusstva, 1917-1928 1928    
JA67 .E35 1895a (VPL) Eichthal, Eugène d', 1844-1936 Souveraineté du peuple et gouvernement 1895    
JA73 .P6584x\1993 \Quarto\   Political science : the state of the discipline II 1993   1878147080
JA76 .P575   Political clientelism, patronage and development 1981   0803997949
JA83 .K6614 (F) Koselleck, Reinhart Règne de la critique c1979 80130042  
JA84.F8 V54 1986 (UGL) JA84.F8 V54 1986 Vernon, Richard, 1945- Citizenship and order : studies in French political thought c1986   0802025889
JA84.G3 E25 1996   Early political writings of the German romantics 1996 95006512 0521445019
Jb53\+933B Blümel, Carl, 1893- Römische Bildnisse 1933    
JBE 00-2157 Heneman, Herbert Gerhard, 1944- Staffing organizations 1999 99034936 0072296003
JC131 E86X\1990\(LC)   Etat moderne, genèse : bilans et perpectives : actes du colloque tenu au CNRS à Paris, les 19-20 septembre 1989 1990 90219220 2222044456
JC336 .C58 1995   Civil society : theory, history, comparison 1995 95007078 0745610617
JC478 .P27 1982 (LC) (SOC)   Patterns of corporatist policy-making c1982 82080178 0803998325
JC479 .N48 2001   New politics of the welfare state 2001 00060670 019829753X
JC571 .K5 King, Preston T 1936- Fear of power: an analysis of anti-statism in three French writers 1967 67079208  
JC578 .L8 Lucas, J. R. (John Randolph), 1929- On justice 1979 79041138 019824598X
JF60 .R45 1991 (F)   Rethinking Third World politics 1991 91011336 0582074592
JF60 .R45 1991 (NNU NYU Bobst)   Rethinking Third World politics 1991 91011336 0582074584
JFD 01-16239 Jeanneney, Jean Noël, 1942- Histoire des médias : des origines à nos jours c2000   2020406837
JFE 00-13922 Uganda Education Association Uganda's educational objectives : a re-examination : proceedings of the Uganda Education Association's 27th annual conference held in the Faculty of Education, Makerere University, Kampala, August 20th-23rd 1974 [1974?] 79980087  
JFE 91-1869 Brohamer, Tom Modern pace handicapping c1991 90041050 0688087825
JFF 95-5208   Qualité de l'information dans les enquêtes = Quality of information in sample surveys c1992   2100011316
JFF 99-3448 Farkas, Steve Time to move on : African-Americans and white parents set an agenda for public schools : a report from Public Agenda c1998   1889483575
JMD 01-329 Leibman, Ludmilla, 1950- Teaching the Holocaust through music 1999    
JMD 01-329 Leibman, Ludmilla, 1950- Teaching the Holocaust through music 1999    
JMF 96-149   25 Ghetto songs : with music and transliteration c1968    
JN\2919 .D82\1997 Duchesne, Sophie Citoyenneté à la française c1997   2724607201
JN2012.P470 1986 (ICU JRL Gen)   Pflicht zum Widerstand : Festschrift Peter Kammerstätter zum 75. Geburtstag c1986 88147407 320350989X
JN2562 .G38 (VPL) Gaudemet, Yves Juristes et la vie politique de la IIIe République. 1970 75505241//r79  
JN2562 .G5 (MAIN) Gicquel, Jean Problèmes de la réforme de l'État en France depuis 1934 1965 68050493  
JQ1872 .P63 1986   Political domination in Africa : reflections on the limits of power 1986 85029985 0521322979
JQ298.B5 A24 Advani, L. K., 1927- Prisoner's scrap-book 1978 78904979  
JV1875.A7 1904 (ICU JRL Gen) France. Ministère des colonies Organisation et fonctionnement de l'École coloniale 1904    
JX1391 .E97x\1996   Explaining international relations since 1945 1996 gb 96028732 0198741952
JX1977.H9 M33 (LAW) Marie, Jean Bernard Commission des droits de l'homme de l'O.N.U. c1975 76473513 2233000161
JZ 4973 .F65 1990 Fomerand, Jacques Strengthening the United Nations economic and social programs : a documentary essay c1990    
K1114 .C66 1993 (PU-L)   Comparative analysis of disclosure regimes [1993?]    
K230.H632 A37x 2000 (law) K230.H632 A37x 2000 (olin)   Path of the law and its influence : the legacy of Oliver Wendell Holmes, Jr. 2000 99054696 0521630061
K235 .J85\1992   Jurisprudence : Cambridge essays 1992 92005714 0198252897
K3150 .P57 1972 Pisier, Evelyne Service public dans la théorie de l'Etat de Léon Duguit 1972 72363980  
K3240.4 .H853 1994 Humphrey, John Thomas Peters, 1905- On the edge of greatness : the diaries of John Humphrey, first director of the United Nations Division of Human Rights 1994- 95153662 0771704402
K3240.4 .H853 1994 Humphrey, John Thomas Peters, 1905- On the edge of greatness : the diaries of John Humphrey, first director of the United Nations Division of Human Rights 1994- 95153662 0771704402
K3585 .O247x 1999 (P) Oberthür, Sebastian Kyoto Protocol : international climate policy for the 21st century c1999   354066470X
K487.E3 P673x 2001 (law) Posner, Richard A Economic structure of the law c2000 00047641 1858986419
K644 .C67 1995 Cornell, Drucilla Imaginary domain : abortion, pornography & sexual harassment 1995 95008510 0415906008
KA662.C5A37 1974.C9N4 (ICU DLL Law) Niehans, Daniel Shareholder and investor under German law 1974    
KD1369 C68X\1990\(LC) Coulter, Moureen Property in ideas : the patent question in mid-Victorian Britain 1990 90034810 0943549094
KD606 .B743 1985 (VPL) British Legal History Conference (7th : 1985 : University of Kent at Canterbury) Political context of law : proceedings of the Seventh British Legal History Conference, Canterbury, 1985 1987 87000088 0907628842
KF\4310 .K56x\1998 King, Thomas F., 1942- Cultural resource laws and practice : an introductory guide c1998 98025397 0761990437
KF2994.A2 C667 1998 (PU-L)   Copyright anthology : the technology frontier c1998   0870841904
KF3114 .W35 1998 (PU vanp) Walterscheid, Edward C To promote the progress of useful arts : American patent law and administration, 1787-1836 1998 97039974 0837713544
KF3775 .E548 1996 (STACKS)   Environmental regulation : law, science, and policy c1996 96075338 0316690562
KF385 .P65 1998 (LRES) Posner, Richard A Economic analysis of law c1998 98107107 1567065627
KF390.5.C6 C58 1999 (PU vanp)   Competition, innovation, and the Microsoft monopoly : antitrust in the digital marketplace : proceedings of a conference held by the Progress & Freedom Foundation in Washington, DC, February 5, 1998 c1999 99017810 0792384644
KF902 .S93\2000 Sweet, Justin Legal aspects of architecture, engineering, and the construction process c2000 99028878 0534953239
KHA462.W65 B37 (F) Bard, Leopoldo Emancipación civil de la mujer : proyecto de ley presentado por el diputado doctor Leopoldo Bard, en la sesión del día 15 de Septiembre de 1924      
KJR1040 .A28\1951 Denmark Danish companies act : no. 123 of 15th April, 1930, as amended by Act no. 160 of 13th Apr., 1938, and Act. no. 88 of 15th Mar., 1939 1951    
KJV\2994\.51966 .A713\1967x France French company law of July 24, 1966, as amended by the law of January 4, 1967 1967]    
KJV\450 .D385x\1958 David, René, 1906- French legal system 1958 58009194  
KKE160.R43 1976   Régestes des arrêts civils et des mémoriaux (1363-1399) des archives du duc de Crète 1976 93105725//r96  
L106 1947 .N3 United States. Office of Education. Division of Secondary Education Life adjustment education for every youth. [1948] e 48000031 /*  
L111.A6 1951 no.3 (ICU JRL Gen) Commission on Life Adjustment Education for Youth Vitalizing secondary education; report [1951] e 51000022 //r54  
L46 .M6   Monitor de la educación común   ca 09000002  
L677.U33 U43 1993 Uganda Government white paper on implementation of the recommendations of the report of the Education Policy Review Commission entitled "Education for national integration and development" [1992] 94846814  
LA1566 .B33 (LEH) Bagunywa, A. M. K Critical issues in African education : a case study of Uganda 1980 81980759  
LA1566 .E38 1991   Education for development c1991 92982065  
LA1567 .P25 2000 (PU muse) Paige, John Rhodes Preserving order amid chaos : the survival of schools in Uganda, 1971-1986 2000 00026127 157181213X
LA222 .C97x Commission on Life Adjustment Education for Youth (1950-1953) Look ahead in secondary education 1954 e 54000025  
LA541 .H55\1996   Historia de la educación en debate 1996 97103947 9509467677
LA546 .N55 1984 (LC) (S) Nigro, Juan Carlos, 1929- Lucha de los maestros : semblanza histórica de la Confederación de Maestros y reseña biográfica de su fundador, Luciano Schilling 1984    
LA548 .A3 (NNU NYU Bobst) Argentina. Ministerio de Educación y Justicia Report upon the state of secondary and normal education in the Argentine Republic 1893    
LA721.81 .F58 ((FTaSU) main,soc) Flessau, Kurt-Ingo Schule der Diktatur : Lehrpläne u. Schulbücher d. Nationalsozialismus 1977 78339602 3431019153
LA721.81 .G45 1993 Giesecke, Hermann Hitlers Pädagogen : Theorie und Praxis nationalsozialistischer Erziehung 1993 93236349 3779910098
LB1025 .Y77 Young, Ella Flagg, 1845-1918 Isolation in the school [1901] 02001798  
LB1050.36 .R47 1988 (PU vanp)   Report card on basal readers c1988 88015130 0913461989
LB1051 .V94\1990   Vygotsky and education : instructional implications and applications of sociohistorical psychology c1990 90031037 052136051X
LB1575.9.S560 1991 (ICU JRL Gen) Shanahan, Timothy Guidelines for judging and selecting language arts textbooks : a modest proposal c1991 91225193//r92  
LB1576 .A6154 1995 (NNU Bobst) Miller, Wilma H Alternative assessment techniques for reading & writing c1995 95000826 0876281412
LB1775 .S64\1988   Social role and evolution of the teaching profession in historical context : conference papers for the 10th session of the International Standing Conference for the History of Education, Joensuu 25-28 July 1988, Finland 1988 89147323 9516967582
LB1775.4 .A7\A45\1993 Alliaud, Andrea Maestros y su historia : los orígenes del magisterio argentino c1993 96155201//r96 9502524284
LB1775.4.A7 A45 1993 Alliaud, Andrea Maestros y su historia : los orígenes del magisterio argentino c1993 96155201//r96 9502524284
LB2037 .C5 (NNU Bobst) Chavarría, Juan Manuel Escuela normal y la cultura argentina [1947] a 48008347  
LB2037 .Y36x\1996 Yannoulas, Silvia C Educar, una profesión de mujeres? : la feminización del normalismo y la docencia, 1870-1930 [1996] 96184534 950136187X
LB2376.L30 1994 (ICU JRL Gen) Laubscher, Michael R Encounters with difference : student perceptions of the role of out-of-class experiences in education abroad 1994 93037505 0313289778
LB2824 .V27 Vaizey, John, 1929- Political economy of education [1972] 72010688 //r85 0470897805
LB2825 .M434 1988   Micro-level school finance : issues and implications for policy 1988 88029202 0887302912
LB2825 .M534 1997 (P) Monk, David H Raising money for education : a guide to the property tax c1997 97004885 0803964064
LB3051 .E273 1996   Educational measurement : origins, theories, and explications c1996 96015021 0761803718
LB3051 .P6142 1995 Popham, W. James Classroom assessment : what teachers need to know c1995 94028527 0205154298
LB3051 .T42 1989 (BMAIN)   Test policy and test performance : education, language, and culture c1989 89002382 0792390148
LC1047.I4 A5 \+\ Indochina. Direction de l'instruction publique Centre de formation professionnelle de Huê 1931    
LC2703\T463 B76\(LC) Brooks, George Washington, 1906- History of the Tennessee Education Congress, 1923-1967 [1975] 75006651  
LC3734 .C97 Cummins, Jim, 1949- Bilingualism and minority-language children c1981 82112696 0774402393
LC3969 .R43 1997   Reducing disproportionate representation of culturally diverse students in special and gifted education c1997 97017073 0865862974
LC4091 .R417x\v.13   Forty years after the Brown decision : implications of school desegregation for U.S. education c1996   0404101135
LC95.U33 O33 1990 (MAIN) Odaet, Cooper F., 1940- Implementing educational policies in Uganda c1990 90040910 0821315862
LD1237.5D 1981 .B769 (EAX) (DIC) Brownstein, Michael Clifford, 1946- Prophet of the inner life : Kitamura Tokoku and the beginnings of romanticism in modern Japanese literature 1981    
LD1237.5D\1998 .M555 Miller, Ann, 1953- Stress, coping and social support : strategies among female substance abusers 1998    
LD1237.5D\2000\.R646 (DIC) LD1237.5D\2000\.R646 Roemer, Nils Holger Historicizing of Judaism in 19th-century Germany : scholarly discipline and popular historical culture 2000    
LE21.C62 B68 Bosch, Beatriz Colegio del Uruguay; sus orígenes, su edad de oro 1949 a 51010295  
LE22.B8 A428 1927q (ANXA)   Album gráfico del Liceo Nacional de Señoritas de la capital : publicado con motivo del vigésimo aniversario de la fundación de dicho establecimiento, 1907-abril-1927 1927    
LE71 .C6 S3 (NNU NYU Bobst) Sagarna, Antonio Colegio del Uruguay 1943    
LINDROTH, LINDA (L) Lindroth, Linda, 1946- Linda Lindroth      
M KUNIY D263 Q (PRINT) Davis, Richard Allen, 1923- Yasuo Kuniyoshi : the complete graphic work 1991   1556600895
M LIN W545 (MAIN) Lin, Maya, 1959- Maya Lin : public/private c1994   1881390055
M1503.R684 S6 1949b Rodgers, Richard, 1902- Richard Rodgers and Oscar Hammerstein II in association with Leland Hayward and Joshua Logan present a musical play, South Pacific c1949   0881880515
Micro-\film\1930\Reel 32\Item 70   Commemorative biographical record of central Pennsylvania : including the counties of Centre, Clearfield, Jefferson and Clarion, containing biographical sketches of prominent and representative citizens 1977    
MICRO-FILM 01040 (NjP SVL) Reed, Carl Hadley, 1925- Motivic unity in selected keyboard sonatas and string quartets of Joseph Haydn 1966    
Microfilm\news 413 Neue Zeitung (Munich, Germany : 1945) Neue Zeitung [microform] 1945-    
microfm AP2.I765 (ICU JRL Mic)   Interview [microform]      
microfm HQ1420.W64 1975 (ICU JRL Mic) Liddle, Helen Gordon Prisoner; a sketch. [Microform] 1911    
microfm HQ1420.W64 1975 (ICU JRL Mic) Zícari, Eduardo Feminismo y la mujer Argentina. [Microform] 1920    
ML120 .I5 B36 1990 Banerji, Sures Chandra, 1917- Companion to Indian music and dance : (spanning a period of over three thousand years and based mainly on Sanskrit sources) 1990 90908480 8170302404
ML136\.B29 P37x\1998 \Quarto\   Settling new scores : music manuscripts from the Paul Sacher Foundation c1998   3795703476
ML1500 .B47 1993 Berger, Melvin Guide to choral masterpieces : a listener's guide 1993 93018714 /MN 0385422482
ML29.1 .B411 (MUSCR) ML29.1 .B411 (UARCH) 3781 1986 B Bedenbaugh, Kay Rubato in the Chopin mazurkas 1986    
ML338 .L38 1998 Latha, Mukunda Transformation as creation : essays in the history, theory, and aesthetics of Indian music, dance, and theatre 1998- 98901459 8186471162
ML338 .P86 1994 (PU vanp) Pundarikavitthala, 16th cent Nartananirnayah 1994-1998 94904814/mn/r98  
ML3560.C5 Z5 1993a (NNU Bobst) Zheng, Su de San Immigrant music and transnational discourse : Chinese American music culture in New York City 1993    
ML3748.W35150 1987 (ICU JRL Gen) Wajid 'Ali Shah, King of Oudh, 1821-1896 Bani : Vajida Ali Saha racita pustaka 1987 88901185 /SA/MN  
ML3800 .C75 1962 Cooke, Deryck Language of music 1962, c1959    
ML3807 .C46 1986 (MUSC) Chowning, John FM theory & applications : by musicians for musicians 1986   4636174828
ML3838 .B78 1997 Bruser, Madeline Art of practicing : a guide to making music from the heart c1997 96045585 /MN 0517708221
ML3838 .B78\1997 Bruser, Madeline Art of practicing : a guide to making music from the heart c1997 96045585 /MN 0517708221
ML410.C88 W46\1997   Whole world of music : a Henry Cowell symposium c1997   9057550040
ML410.H41 S33+ 1969a Saslav, Isidor Tempos in the string quartets of Joseph Haydn 1969    
ML410.M23 M137 1990 McShane, David H Gustav Mahler's Des Knaben Wunderhorn Lieder 1985    
ML410.M939 H78 (MUS) Horn, Geoffrey Clark Dual Urlinien in the concerto practice of Wolfgang Amadeus Mozart : as demonstrated in the three concerti in Eb for horn and orchestra, K. 417, K. 447, and K. 495 1989    
MnU-D 75-356 (WALT) 9ZAR08D37S10TBP Pankake, Marcia Americans abroad: a bibliographical study of American travel literature 1625-1800 1975    
MT145.B47 P47 1995 Perle, George, 1915- Style and idea in the Lyric suite of Alban Berg c1995 95016154 /MN 0945193653
MT145.S26 P475 1986a Petree, Katherine F Performance practices in the piano music of Arnold Schoenberg / : by Katherine F. Petree 1986    
N 2830 .C3s 1983 Q (MAIN) Fittschen, Klaus Katalog der römischen Porträts in den Capitolinischen Museen und den anderen kommunalen Sammlungen der Stadt Rom 1983- 84175558 3805305826
N 6494 .I56 B58 1997 Museum of Contemporary Art, San Diego Blurring the boundaries : installation art 1969-1996 c1997 94075415 0934418446
N 6512 .B76 1997 (v.1-2) Brody, David Eric Fantasy realized : the Philippines, Orientalism, and imperialism in turn-of-the-century American visual culture 1997    
N\5740\W89 Teitz, Richard Stuart Masterpieces of Etruscan art; [exhibition at the] Worcester Art Museum, April 21 to June 4, 1967 1967] 67068039 //r86  
N0 G338 A4 1999   Orazio Gentileschi en la corte de Carlos I 1999   8487184502
N330 W64 v.8 (WILB) \\OFFICE\COPY\\N650\J54\B79\ Brooklyn Museum Ancient Greek and Roman gold jewelry in the Brooklyn Museum 1984   0913696315
N3450.A6 C37 1972 (STK) Museo del Prado Catálogo de las pinturas : Museo del Prado 1972 72352959  
N370.41 M56 (WILB) Metwalli, Ahmed Mohamed, 1940- Lure of the Levant. The American literary experience in Egypt and the Holy Land: a study in the literature of travel,1800-1865 1971]    
N405 .W5x no.10016 (P)   Caravaggio y el naturalismo espa~nol [1973]    
N44.B7684 P34 (MAIN) Palais des beaux-arts (Brussels, Belgium) Oeuvre d'Antoine Bourdelle 1928    
N44.G724 L353 (MAIN)   Goya, cinco estudios      
N44.K964 M94 (MAIN) Myers, Jane, 1955- Shores of a dream : Yasuo Kuniyoshi's early work in America c1996 96031120 0883600862
N44.M977 G37 (MAIN) García Felguera, María de los Santos Fortuna de Murillo, 1682-1900 1989   8477980292
N5010 .P23\C39\no.3 U.S. Centre culturel américain, Paris Trois américains, Art Brenner, Robert Colescott, Elaine Hamilton. Exposition du 26 février au 26 mars 1969 1969]    
N5010.A615.M5 no.11 (ART) Michigan. University. Museum of Art Manet and Spain, prints and drawings 1969    
N5020 .H3 1954 (HIS)   Ancient art in American private collections : a loan exhibition at the Fogg Art Museum of Harvard University, December 28, 1954-February 15, 1955 : arranged in honor of the seventy-fifth anniversary of the Archaeological Institute of America 1954 a 56000290  
N5750 .D9 (HIS) Ducati, Pericle, 1880-1944 Storia dell'arte etrusca .. 1927 a 35000039 //r78  
N638 R34R43 (WILB) Rhode Island School of Design (Providence). Museum of Art Catalogue of the classical collection [1972]    
N6512 .D584 1984 (FAL)   Disarming images : art for nuclear disarmament c1984 84020516 0915361140
N6512 .K54 (ART) \(LC)\ Klein, Michael R Four artists 1976    
N6512.S635 T36 1994 Tannenbaum, Judith, 1944- Mimi Smith : steel wool politics c1994 93081283 0884540731
N6847.5.I4 I85 1997a (MAIN) Iskin, Ruth E Impressionism, women and the public sphere of modernity 1997    
N6911 .L66 1961 (HIS) Longhi, Roberto, 1890- Scritti giovanili, 1912-1922 1961 65086647  
N6915 .C59 1983 (COPM) N6915 .C59 1983 Clark, Kenneth, 1903-1983 Art of humanism [1983] 82048689 0064308618
N6921\.V5 H56\1999 \Quarto\ Hills, Paul Venetian colour : marble, mosaic, painting and glass, 1250-1550 c1999 99020880 0300081359
N7101 .S21 v.1-5 (NjP SA) Sánchez Cantón, F. J. (Francisco Javier), 1891-1971 Fuentes literarias para la historia del arte español 1923-41 26001503 //r33  
N7113.G68 G686 1994   Goya : neue Forschungen : das internationale Symposium 1991 in Osnabrück c1994 95157954 378611742X
N72 M28 N48 1985 Alternative Museum (New York, N. Y.) Disinformation : the manufacture of consent c1985   0932075010
N724 Scu4H8 (WILB) Hus, Alain Recherches sur la statuaire en pierre étrusque archaïque 1961 64044290  
N7560 .I58 1986 (FINE) N21 .I585 1986 \*\ International Congress of the History of Art (26th : 1986 : Washington, D.C.) World art : themes of unity in diversity : acts of the XXVIth International Congress of the History of Art c1989 86043252 0271006072
N7588 .B5 ((FTaSU) main,hum) Bernoulli, Johann Jakob, 1831-1920 Römische Ikonographie 1882-94 06022528  
N7588 .M86 1986 (MAIN) Musée du Louvre Catalogue des portraits romains 1986-   2711820327
N8237.25 .P47 2001 (PU fine) Pernoud, Emmanuel Bordel en peinture : l'art contre le goût c2001   287660230X
NA5065 C37 1981 Carli, Enzo, 1910- pulpito interno della cattedrale di Prato 1981    
NA997.J7 S8 (MAIN) Strong, Roy C Britannia triumphans : Inigo Jones, Rubens and Whitehall Palace c1980 80052042  
NB115 .P74 2001 (NjP sa) NB115 .P74 2001 (NjP anxa) Princeton University. Art Museum Roman sculpture in the Art Museum, Princeton University c2001   0943012341
NB1265 .B66x (P) Bonghi Jovino, Maria Terrecotte votive; catalogo del Museo provinciale campano [1965- 68120922//r78 8822238265
NB1280 .S3 (P) Sadurska, Anna Tables iliaques 1964 66080102  
NB1309.M37 1983 (ICU JRL Gen) Meriçboyu, Yildiz Istanbul Arkeoloji Müzesindeki büst seklinde kantar agirliklari = Steelyard weights in the form of busts in the Archaeological Museum of Istanbul 1983    
NB164 .P6 (HIS) Poulsen, Frederick, 1876- Greek and Roman portraits in English country houses 1923 24011040  
NB1950 A236\1993\(LC)   Acanthe dans la sculpture monumentale de l'antiquité à la Renaissance 1993   2735502805
NB237\.E2 A4\1980 Eberle, Abastenia St. Leger, 1878- Abastenia St. Leger Eberle, sculptor (1878-1942) : Des Moines Art Center, July 15-August 17, 1980 c1980 80066884  
NB85 .C82 (SA) NB85 .C79 1951 Ny Carlsberg glyptotek Catalogue of ancient sculpture in the Ny Carlsberg Glyptotek 1951    
NB87 .B65 1925 (HIS) Museum of Fine Arts, Boston Catalogue of Greek and Roman sculpture 1925 25005089  
NC795 .L4 1993 (BMAIN) Leslie, Clare Walker Art of field sketching 1993 92040243 0879055553
Nc92\861eb   Eighty years' progress of the United States from Revolutionary War to the great rebellion, showing the various channels of industry through which the people of the United States have arisen from a British colony to their present national importance . 1864    
NC997.A4 E86 1984   Ethnic images in advertising c1984    
ND 623 .G3646 A4 1999 (LEE)   Orazio Gentileschi at the court of Charles I 1999 gb 99022102 8487184502
ND\3161\.V54 M56\1986   Miniatura veronese del Rinascimento 1986    
ND\623\.G333 A4\1999   Orazio Gentileschi at the court of Charles I 1999   8487184502
ND1130 .H5613 1979 (FINE) Hollanda, Francisco de, 1517-1584 Four dialogues on painting [1979] 78020470 0883558483
ND212 .C63x\1993 \folio\ Exhibition of Contemporary American Painting (43rd : 1993 : Corcoran Gallery of Art) 43 : 43rd Biennial Exhibition of Contemporary American Painting 1993 93079576 0886750407
ND237.B97 M12 McCausland, Elizabeth, 1899-1965 David Burliuk: 55 years of painting [1962]    
ND237.K83 A4 1982 (EAST)   Amerika ni mananda Nihon no gakatachi : Kuniyoshi, Shimizu, Ishigaki, Noda to Amerikan shin kaiga = Japanese artists who studied in U.S.A. and the American scene c1982    
ND237.K83 W65 1993 (MA) Wolf, Tom Yasuo Kuniyoshi's women 1993 93004337 1566403200
ND237\.C66 A2\1991\VTN910   Robert Colescott interview [videorecording] 1991    
ND2895.P5A5 (ICU JRL Gen) Pierpont Morgan Library Glazier Collection of Illuminated Manuscripts 1968 68017003 //r85  
ND3161.V4 M3 (FINE) Mariani Canova, Giordana Miniatura veneta del Rinascimento, 1450-1500 [1969] 79495239  
ND456 .B79 1997 Burke, Marcus B Collections of paintings in Madrid, 1601-1755 c1997 97021522 0892364963
ND547.5.I4 R84 1999 Rubin, James Henry Impressionism 1999   0714838268
ND616 .L4 Levey, Michael Later Italian pictures in the collection of Her Majesty the Queen [1964]    
ND616 .L4 Q Levey, Michael Later Italian pictures in the collection of Her Majesty the Queen [1964] 64054941  
ND621 .V5\B67 Bonicatti, Maurizio Aspetti dell'umanesimo nella pittura veneta dal 1455 al 1515 [1964] 66059891  
ND621.N2P480 1985 (ICU JRL Gen)   Pintura napolitana de Caravaggio a Giordano : Palacio de Villahermosa, octubre/diciembre 1985, Museo del Prado [1985?] 87109209 8450521610
ND623.B39A683 1985 (ICU JRL Gen) Belting, Hans Giovanni Bellini, Pietà : Ikone und Bilderzählung in der venezianischen Malerei 1985 85202628 3596239273
ND623.V5 H33 Hadeln, Detlev, Freiherr von, 1878-1935 Paolo Veronese 1978    
ND673.R82 A75\1983 Brown, Christopher, 1948- Rubens, Samson and Delilah c1983   0901791857
ND688.F88 2000 (ICU JRL Gen)   Futurismus in Russland und David Burliuk, "Vater des russischen Futurismus" : Staatliches Russisches Museum ; Von der Heydt-Museum Wuppertal und Kunst- und Museumsverein Wuppertal 2000 00435535 3930775913
ND699.B95A4 1994 (ICU JRL Gen) Burliuk, David, 1882-1967 David Burliuk : faktura i tsvet : proizvedeniia Davida Burliuka v muzeiakh rossiiskoi povintsii 1994    
ND699.B96 G62 \+\ Gollerbach, Erikh Fedorovich, 1895 Iskusstvo Davida D. Burliuka. Art of David Burliuk 1930    
ND804 .C25 (NjP SA) Carducci, Vincenzio, 1578-1638 Diálogos de la pintura 1865    
ND811.S5 V34 (ART) Valdivieso, Enrique Catálogo de las pinturas de la Catedral de Sevilla 1978 79385634 8440042043
Ndq51\908B Bouglé, Célestin Charles Alfred, 1870-1940 Syndicalisme et démocratie : impressions et réflexions 1908    
NE\647\.6\.P6 I88\1998 Ittmann, John W Post-impressionist prints : Paris in the 1890s 1998 97048844 0876331193
NE539.K86 A4 1991 f Davis, Richard A Yasuo Kuniyoshi : the complete graphic work 1991   1556600895
Nfd10\1\1933 Peil', V. A Novaia epokha: ideokratiia; politika-ekonomika; obzory 1933    
NJ18\F717 +L57\FKW\2557\1996\(LC) Harrison, Martin, 1945- Lisa Fonssagrives : three decades of classic fashion photography 1996 96018030 0865659788
NK1678.V66 P65 1997 (P) Polk, Patrick Arthur Haitian Vodou flags c1997 97014002 1578060249
NK5107 .V37 1959 (ARTL) Biblioteca apostolica vaticana. Museo sacro Gold-glass collection of the Vatican Library : with additonal catalogues of other gold-glass collections 1959    
NK5860 .M3 (HIS) Marangou, Evangelia-Lila I Lakonische Elfenbein- und Beinschnitzerein (1969) 74581175  
NK6196 .L53 1984 (NNU Bobst)   Lighting in America : from colonial rushlights to Victorian chandeliers 1984 84000897 0915590409
NK7303.B47 I53 ((FTaSU) main) Indiana University. Museum of Art Ancient jewelry from the collection of Burton Y. Berry 1973]    
NK9698.A83 A8 Aycock, Alice Project entitled "The beginnings of a complex ... " (1976-77) : notes, drawings, photographs c1977 77084885 0093078059
no. 000459 \*ZAN-3020 Burgos, Julia de, 1914- Mar y tú, otros poemas 1954    
Non-circulating (NNNS NSSR NewSchool Microform) Non-circulating (NNNS NSSR NewSchool Thesis) Richardson, Laura Social network characteristics and substance abuse treatment outcome 1999    
Non-circulating LD3907.E3 1988 .G82 (NNU Bobst Microform) LD3907.E3 1988 .G82 (NNU Bobst) Guirguis, Sonia A Image of Egypt in The New York times, 1956, 1967, 1979 1988    
Non-circulating LD3907.G7 1995 .R45 (NNU Bobst Microform) LD3907.G7 1995 .R45 (NNU Bobst) Reichl, Alexander J Politics and culture in urban development : the reconstruction of Times Square c1995    
Non-circulating LD3907.S3 1997 .L38 (NNU Bobst Microform) LD3907.S3 1997 .L38 (NNU Bobst) Laudante, Lisa M Self-image and self-esteem of female adolescents who engage in disturbed eating and the practice of unsafe sex c1997    
none   Organic geochemistry      
NX170 .P46 1994 (CSt SAL STACKS)   Pensée de l'image : signification et figuration dans le texte et dans la peinture c1994 95180867  
NX180.S6 R44x 1990 (P)   Reimaging America : the arts of social change c1990   0865711690
NX549.A1 R5 1993 (P) Ribner, Jonathan P Broken tablets : the cult of the law in French art from David to Delacroix c1993 92023046 0520077490
NX571.U474B876 1993 (ICU JRL Gen) Noha, Oles', 1959- Davyd Burliuk i mystetstvo vsesvitn'oho avanhardu 1993    
NX650.R25 P75 1989 (LC) (ART)   Prisoners of image : ethnic and gender stereotypes : January 7-March 4, 1989, Alternative Museum, New York c1989 88084137 093207524X
Ocg75\H129\964 Halbecq, Michel État : son autorité, son pouvoir, 1880-1962 1964    
Oversize E97.6.C2 P91 + (olin) Pratt, Richard Henry, 1840-1924 Battlefield and classroom 1964 64020931  
P\299\Q3\S93x\1993 Swart, Henriëtte de, 1961- Adverbs of quantification : a generalized quantifier approach 1993 93006928 0815314302
P\85.\B16 B16   Bakhtin, essays and dialogues on his work 1986 85024624 0226541339
P\85\.B16 U58\1994 Universidad Nacional de Educación a Distancia. Instituto de Semiótica Literaria y Teatral. Seminario Internacional (4th : 1994 : Madrid, Spain) Bajtín y la literatura : actas del IV Seminario Internacional del Insitituto de Semiótica Literaria y Teatral, Madrid, UNED, 4-6 de julio, 1994 1995 95197989 8475224725
P118 .P484 1992 (F)   Phonological development : models, research, implications c1992 92001152 0912752246
P118.2 .E39 1991 (F) (SW) Ellis, Rod Second language acquisition & language pedagogy c1992 91032201 185359136X
P118.2 .H47 2000 (PU vanp) Herschensohn, Julia Rogers, 1945- Second time around : minimalism and L2 acquisition c2000 99058276 9027224897
P118.2 .L53x\1996 Liceras, Juana M Adquisición de las lenguas segundas y la gramática universal [1996]   8477383871
P118.2 .V94 1994 (F)   Vygotskian approaches to second language research c1994 93049680 1567500242
P118.2 A33X\1992\(LC)   Adquisición de las lenguas extranjeras : hacia un modelo de análisis de la interlengua c1992 93248099 8477748640
P155\.B52 Bidwell, Annie E. Kennedy Dear General : the private letters of Annie E. Kennedy and John Bidwell, 1866-1868 1993, c1994 93074235  
P158 W29\1997\(LC)   Ways of scope taking c1997   0792344464
P161 .M67 1994 Morrill, Glyn V Type logical grammar : categorial logic of signs c1994 94033169 0792330951
P165 D57X\1997\(LC)   Discourse and perspective in cognitive linguistics c1997 97039411 9027236550
P21 .L752 (olin)   Linguistics in the Netherlands   88640603  
P217 .S298 1997 (NNU Bobst) Scobbie, James M Autosegmental representation in a declarative constraint-based framework 1997 97017752 0815329490
P231 .P37x 1979 (F)   Papers on syllable structure, metrical structure, and harmony processes [1979?] 89139541  
P26.D54 U637 1990g   Unity in diversity : papers presented to Simon C. Dik on his 50th birthday 1990   9067655112
P271 H66X\1996\(LC) Hoop, Helen de, 1964- Case configuration and noun phrase interpretation 1996 96021117 0815325606
P271 H66X\1996\(LC) Hoop, Helen de, 1964- Case configuration and noun phrase interpretation 1996 96021117 0815325606
P291 .S38 1992   Satz und Illokution 1992- 92236526//r93 348430278X
P299 .Q3 F567 1994B (CSt GREEN STACKS) Fintel, Kai von Restrictions on quantifier domains c1994    
P302 .D564x 1999 (olin)   Discourse reader 1999 98032357 0415197333
P302 .L587 1999 (CSt GREEN STACKS)   Logical relations in discourse c1999 98061616 1556710402
P306.A1 A53 vol.10 (NNU NYU Bobst)   Translation and medicine 1998   9027231850
P35.5.P7 H36 1996 (NNU Bobst) Hannan, Kevin, 1954- Borders of language and identity in Teschen Silesia 1996 96019239 0820433659
P381.A75 P48 1997   Phonologies of Asia and Africa : : (including the Caucasus) 1997 97004964 1575060175
P40 .S5444 1996   Social interaction, social context, and language : essays in honor of Susan Ervin-Tripp 1996 96018567 0805814981
P53 .L35 1991   Language awareness in the classroom 1991 90019557 0582067375
P85.B22 B35 1986 (VPL)   Bakhtin, essays and dialogues on his work 1986 85024624 0226541339
P99 .S484 1984 (P)   Sign, system, and function : papers of the first and second Polish-American semiotics colloquia c1984 84003288 9027932700
PA3113 .B38 1993 Bartol, Krystyna Greek elegy and iambus : studies in ancient literary sources 1993   8323205299
PA3113 .W4 West, Martin Litchfield Studies in Greek elegy and iambus 1974 73093168 3110045850
PA3825\A6 V367\1991 Vellacott, Philip English reader's guide to Aeschylus' Oresteia 1991-1993   0951827006
PA4399\P15 +B37\2001 Posidippus, of Pella, b. ca. 310 B.C Epigrammi : P. Mil. Vogl. 8. 309 c2001   8879161652
PA4413.A7 B46 1998 (P) Benardete, Seth Sacred transgressions : a reading of Sophocles' Antigone 1999 98006763 1890318779
PA6482 .A3 1984 (MAIN) Lucretius Carus, Titus De rerum natura I c1984   0862920760
PA6648\P6 P477X\1993 Roberts, Michael John, 1947- Poetry and the cult of the martyrs : the Liber peristephanon of Prudentius c1993 93031245 0472104497
PA6803.B32 M34x 1992 (olin) Virgil Virgil, Aeneid, Book XII 1992 gb 93027818 1853992445
PA6807\A5 D39\Suppl Williams, R. D. (Robert Deryck), 1917- Aeneid of Virgil : a companion to the translation of C. Day Lewis, with introduction, commentary & glossary 1985   0862920442
PA8079 .S374 2001 (NNU NYU Bobst)   Sapere delle parole : studî sul dialogo latino e italiano del Rinascimento : giornate di studio, Anversa, 21-22 febbraio 1997 c2001   8883196007
PA8570.R44 A7\1970 Reuchlin, Johann, 1455-1522 Henno. Komödie. Latein. u. dt [1970] 76157203  
Pamphlet\FL\Argentina\198 Santos, Cloe de los Mujer argentina en la época de la emancipación 1931    
PB35 .C85\1994   Culture and language learning in higher education c1994 93050831 //r94 1853592285
PC153 .F37 1985 (VPL) Farkas, Donka Intensional descriptions and the romance subjunctive mood 1985 85015854 0824054261
PE1068.S7 C36 1999g Canagarajah, A. Suresh Resisting linguistic imperialism in English teaching 1999   0194421546
PE1404 .N435 1998 (MASTK)   Negotiating academic literacies : teaching and learning across languages and cultures 1998 98013599 0805829989
PE1505 O37X\1998 Oliver, Mary, 1935- Rules for the dance : a handbook for writing and reading metrical verse 1998 98002625 039585086X
PE26\.A46 I49x\1999   Intercultural encounters - studies in English literatures : essays presented to Rüdiger Ahrens on the occasion of his sixtieth birthday 1999   3825308499
PF3025 .S87\nr.41   Interfaces in phonology 1996   3050029641
PF3315.S82 B87x 1984 (MAN) Buscha, Joachim Konjunktiv 1984    
PF3321.H36 1995 (ICU JRL Gen) Helbig, Gerhard Deutsche Partikeln--richtig gebraucht? 1995   3324006082
PG\3505\.I94 F65x\1994   Fol'klor i literatura Ivanovskogo kraia : stat'i, publikatsii, materialy 1994- 95175576 5230022531
PG2925 .P68 1999g Potaennaia literatura: voprosy istorii i tipologii (1999 : Ivanovskii gosudarstvennyi universitet) Potaennaia literatura : issledovaniia i materialy 2000   5780701539
PG3489.8\.E687 A27 1993 Yermakov, Oleg Afghan tales : stories from Russia's Vietnam c1993 92046348 0688123945
PG3512.U8E6 1930 (ICU JRL Gen) Burliuk, David Davidovich, 1882- Entelekhizm [1930]    
PJ3002.Z5 L368 1987   Working with no data" : Semitic and Egyptian studies presented to Thomas O. Lambdin 1987 87030571 0931464358
PJ5208.A5 N321 \+\ Naveh, Joseph 'Al pesefas ve-even : ha-ketuvot ha-Aramiyot veha-'Ivriyot mi-bate ha-keneset ha-'atikim 738, 1978 78951880  
PJ8417.A5 L58 2000 (HIS)   Literature of Al-Andalus 2000 00022599 0521471591
PK1718.C45 A26 1996g Cattopadhyaya, Saratcandra, 1876-1938 Devdas and other stories c1996 96906611 8174360301
PL 790 .S3 E5 1998 (LEE) Saigyo monogatari. English Tale of Saigyo = (Saigyo monogatari) 1998 97025714 0939512831
PL2333 .L5\1997 Li, Tien Writing in crisis : translation, genre and identity in modern Chinese poetry 1997    
PL381 .K7 (MAIN) Krueger, John Richard, 1927- Chuvash manual : introduction, grammar, reader and vocabulary 1961 62062548 /L  
PL4389.N596 R7 Nguyên-phan-Long Roman de Mademoiselle Lys. (Journal d'une jeune fille Cochinchinoise moderne) 1921    
PL5295 .T581 (GL) Topping, Donald M Chamorro reference grammar [c1973] 72098012 0824802691
PL538.C6 T344 1991 (GEST)   Talking business in Japanese 1991   4789005968
PL7101.W64 D64 (VPL) Donaldson, Tamsin Ngiyambaa : the language of the Wangaaybuwan 1980 79007646 0521225248
PL8233 .B3 1993 Bargery, G. P Hausa-English dictionary and English-Hausa vocabulary 1993    
PN173 .R44 1986 (GLX)   Rhetorics of Thomas Hobbes and Bernard Lamy c1986 85030448 0809313014
PN1990.6.F8 S68 1984 f (STK)   Sources de l'histoire de la radio et de la télévision en France c1984 85181068  
PN1993.5.I8 I496 1983   Indian cinema superbazaar c1983 83904296 0706922263
PN1997.N85 R38 1987 (H) Raskin, Richard Nuit et brouillard by Alain Resnais : on the making, reception and functions of a major documentary film : including a new interview with Alain Resnais and the original shooting script 1987   8772881003
PN1997\A1 G6313\1975b Godard, Jean Luc, 1930- Woman is a woman ; [and] A married woman ; [and], Two or three things I know about her : three films 1975   0856470538
PN1998.3\.K54 A3\1993 Kieslowski, Krzysztof, 1941- Kieslowski on Kieslowski 1995, c1993 gb 94085458 0571173284
PN1998.3\.K54 I58\1999 Insdorf, Annette Double lives, second chances : the cinema of Krzysztof Kieslowski c1999 99021348 0786865628
PN1998.A3 B7 Droguet, Robert Robert Bresson .. 1966 67088996  
PN2285 .S86 1998 (PU vanp) Sullivan, Steve Bombshells : glamour girls of a lifetime 1998 98004618 0312167903
PN2287.F55 A3 1976 (STK) Flynn, Errol, 1909-1959 My wicked, wicked ways [1960, c1959] 59007849 /L  
PN241 .M26 1985b (GLX)   Manipulation of literature : studies in literary translation c1985 85010730 //r87 0312512880
PN241 .T698 1996   Translatability of cultures : : figurations of the space between 1996 95013052 0804724849
PN2595 .W75 1998g   Writing live : an investigation of the relationship between writing and live art c1998   0953349101
PN5146.D66 A3 2000 (NjP dixn) Donegan, Lawrence No news at Throat Lake c2000 99089574 0671785400
PN56\.A33 B49x\1994   Beyond the pleasure dome : writing and addiction from the Romantics c1994   1850753784
PN6071.G27 B59 1997 (ANXA) PN6071.G27 B59 1997   Bloom & blossom : the reader's guide to gardening c1997 96026828 0880014733
PN6115 .C6 no.63 (P)   Venexiana 1969, c1965    
PN721 .T95\1993 Tylus, Jane, 1956- Writing and vulnerability in the late Renaissance 1993 92032209 0804721386
PN771 .E44 2001 (PU vanp) Ellison, David R Ethics and aesthetics in European modernist literature : from the sublime to the uncanny 2001 2001025769 0521806801
PN81 .E65 1996   Essays in memory of Michael Parkinson and Janine Dakyns 1996 96188118  
PN98.P67 L56 1994 (NNU Bobst)   Liminal postmodernisms : the postmodern, the (post-)colonial, and the (post-)feminist 1994   9051837569
PQ\4617\.C6 Z79x\1997   Per Giovanni Della Casa : ricerche e contributi : Gargnano del Garda (3-5 ottobre 1996) c1997 98102594 8820507978
PQ\7798\.1\.I7 C8\1998 Aira, César, 1949- Curas milagrosas del doctor Aira : novela 1998 98173575 9879243072
PQ2191.P42V2 1970 (ICU JRL Gen) Baudelaire, Charles, 1821-1867 Paris spleen, 1869 1970] 7420589//r916  
PQ2191\.Z5 B358\2001   Baudelaire and the poetics of modernity 2001 00010466 0826513778
PQ2198\B38 O7\1980 Bonnetain, Paul, 1858-1899 Opium [microform] 1909    
PQ2601.B77 F8 About, Noële Edmond, 1914- Frère jaune [1937] 38018719  
PQ2601.L52 U5 Alem, Gilbert d' Une des sept : roman annamite c1930    
PQ2603.E52 F6\1924 Bellan, Charles Fleur de Lotus 1924 24030416  
PQ2603.O765 F2 Bouquet, Henry Fausse vocation : roman indochinois 1929    
PQ2607.E834 Z73413 (VPL) \\OTHER\COPIES\Annenbg\ (ANNBG) Kristeva, Julia, 1941- Powers of horror : an essay on abjection 1982 82004481 0231053460
PQ2607.E85H5 1916 (MAN) Nolly, Emile, b. 1880 Hiên le Maboul [1908]    
PQ2607.I65 D8 Diraison-Seylor, Olivier, 1873- Du fond des abîmes : journal de Charles Dynvic, surveillant des travaux public au Laos 1911    
PQ2607.U17 J3 Duclos-Salesses, Jeanne Janou la tonkinoise 1926 [i.e. 1928]    
PQ2609.S91 T4 Estray, Jean d' Thi-Sen, la petite amie exotique [1911] 11017843  
PQ2613.A925 M5 Gaultier, Marcel Messagère : roman 1943    
PQ2623.A92 T8 Laumônier, Henri Trois années de poste : roman tonkinois [1909]    
PQ2631.O9 M2 Matgioï, 1861-1939 Maître des sentences 1899    
PQ2635.E56 M6 Renaud, Jean, 1882- Mirages d'exil 1914    
PQ2663.O6 Z537 1991 (ANXA) Aira, César, 1949- Copi 1991 91818917 9509976601
PQ3979.V72 P4 Villedieu, René de Petit-fils d'Asie : fils de France 1942    
PQ3999.C43 V35 1990 Chaze, M Vai : la rivière au ciel sans nuages 1990    
PQ4561.A1 V4 1974 (MAIN) Venexiana Veniexiana 1974    
PQ4699 .C768 2000 (NjP f) Crotti, Ilaria Libro, mondo, teatro : saggi goldoniani 2000   8831773437
PQ4817 .I22\C6 Giacosa, Giuseppe, 1847-1906 Come le foglie [1961] 61049109  
PQ4862.A69T67 1993 (ICU JRL Gen) Barbieri, Renzo Top model 1993 94139488 8845406040
PQ6085 .A38 1994 (PU vanp) Agosin, Marjorie Otro modo de ser : poesía hispánica de mujeres c1994   1881708047
PQ6651.M37 D56 1994g Amestoy Egiguren, Ignacio, 1947- Dionisio Ridruejo. : Una pasion española ; No pasarán! Pasionaria 1994   8424506561
PQ6651.M37 E45 1996 (PU vanp) Amestoy Egiguren, Ignacio, 1947- Elisa besa la rosa (Elixa) ; La reina austríaca de Alfonso XII 1996 96162677//r98 842450710X
PQ6651.M37 Y6 1993g Amestoy Egiguren, Ignacio Yo fui actor cuando Franco ; Mañana, aqui, a la misma hora 1993?   8424506235
PQ7081 .Z36 Zapata, Celia Ensayos hispanoamericanos c1978 78113895  
PQ7440.A69 N6 1991 (NNU Bobst) Abreu Adorno, Manuel, 1955-1984 No todas las suecas son rubias 1991 87080413 //r93 0865814066
PQ7689 .T383 1992 (BMAIN)   Teatro argentino durante el Proceso, 1976-1983 : ensayos críticos, entrevistas c1992 93202987 9508430079
PQ7797.B53 R3 1981 (GLX) Bianco, José Ratas c1981 81176488  
PQ7797.M37 E8 1961 (PU stor) Mercante, Victor, 1870-1934 Estudiantes [1961] 65053759  
PQ7798.1.I7 M385 1998 (PU vanp) Aira, César, 1949- Mendiga 1998   987972111X
PQ7798.1.I73 C66 1991 Aira, César, 1949- Copi 1991 91818917 9509976601
PQ7798.1.I73 E43x 1981 (P) Aira, César, 1949- Ema, la cautiva c1981 82156357  
PQ7798.1\.I7 L5 1991 Aira, César, 1949- Liebre c1991 93232242 9500410842
PQ7798.26.A88 M53 1999 (NNU NYU Bobst) Pavlovsky, Eduardo A Micropolítica de la resistencia 1999   9502309995
PQ7798.26\A88 Z4\2001 Pavlovsky, Eduardo A Tica del cuerpo : nuevas conversaciones con Jorge Dubatti c2001 2001414331 9879006798
PQ8497.P17 C9 1959 Palma, Clemente, 1872-1946 Cuentos malévolos 1974    
PQ8497.P2 H4x (P) Paima, Clemente, 1872- Historietas malignas 1925    
PR\888\.L46 B49x\1998   Beyond sex and romance? : the politics of contemporary lesbian fiction 1998   0704345374
PR\9199\.3\.K78 I8\1994 (URIS) PR\9199\.3\.K78 I8\1994 Kogawa, Joy Itsuka 1994 93026076 0385468857
PR226 .D55 1995 DiNapoli, Robert Index of theme and image to the homilies of the Anglo-Saxon church : comprising the homilies of Ælfric, Wulfstan, and the Blickling and Vercelli codices 1995 95223627 189828105X
PR6053.R455 S67\2000 Cremins, Robert, 1968- Sort of homecoming 2000 99089011 0393320235
PR6057.R389 E87 1996 (NNU NYU Bobst) Greig, David Europe ; The architect 1996   0413708802
PR6062 .U16 S5 1997 (CSt GREEN STACKS) Lucie, Doug, 1953- Shallow end 1997 gb 97024131 0413716805
PR6062.U16 P53 1998g Lucie, Doug, 1953- Plays : 1 1998   0413716902
PR821 .L43 1985 Leeson, Robert Reading and righting : the past, present, and future of fiction for the young 1985 86156602 000184413X
PR868.T3 S35 1986 (BAKR) Sedgwick, Eve Kosofsky Coherence of Gothic conventions 1986, c1976 86005212 0416014119
PR9364.9 .R86 2000   Running towards us : new writing from South Africa c2000 99049243 0325002312
PR9484.6 .H9 1998 (NNU NYU Bobst)   Hybridity and postcolonialism : twentieth-century Indian literature 1998   3860577301
PR9484.6 .R35x\1992   Raj nostalgia : some literary and critical implications c1992   0725805234
PS3505 .O2453\C65\1945 Cohen, Lester, 1901-1963 Coming home : a novel 1945 45004134  
PS3513.O65 R66 ((FTaSU) main,hum) Gosselink, Sara Elizabeth, 1893- Roofs over Strawtown [1945]    
PS3513.U353.Z465 (MEYER) PS3513.U353.Z465 Guérard, Albert Joseph, 1914- Touch of time : myth, memory, and the self c1980 79092177  
PS3515.I713 R35 1985 (STK) Himes, Chester B., 1909- Rage in Harlem 1985, c1957   0850316189
PS3521 .E86\I7\1966 Keyes, Frances Parkinson, 1885-1970 I, The king [1966]    
PS3552.L552 S4 1980 (VPL) Bloch, Chana, 1940- Secrets of the tribe : poems c1980 80052193 0935296131
PS3554.E667 S44 1996 Derbyshire, John Seeing Calvin Coolidge in a dream 1996 95025613 0312140444
PS3554.U265 H68 2000 Dubus, Andre, 1959- House of sand and fog 2000 99044258 0375708413
PS3558 .E79785 C58 1996 Hess, Joan Closely akin to murder 1996 95046862 0525939113
PS3558.E787 T3 1991 Hershman, Marcie, 1951- Tales of the master race c1991 90056363 0060166444
PS3569.C5658 R47 1998 Schwartz, John Burnham Reservation Road 1998 98014580 ///r98 0375402632
PS3569.T3868 D53 1996 (NNNS NewSchool) Stephenson, Neal Diamond age 1996   0553573314
PS3573.E255 P3 1999 Webster, Brenda S Paradise Farm c1999 98026875 0791440990
PS3573\.E255 Z465\2000 Webster, Brenda S Last good Freudian 2000 00020442 0841913951
PS374\.S35 S63\2000   Space and beyond : the frontier theme in science fiction 2000 99033689 0313308462
PS42 .R4\1992   Reading their world : the young adult novel in the classroom c1992 92022108 0867093064
PS509.W62 I58 1998 (NNU Bobst)   Intimate nature : the bond between women and animals 1998 97033598 0449911225
PS648.F3 B6 1984 Boyer, Robert H., 1937- Fantasists on fantasy : a collection of critical reflections c1984 83091186 038086553X
PT\179 .A73x\1992 Arbeitskreis Deutsche Literatur des Mittelalters. Jahrestagung (27th : 1992 : Mölln, Austria) Schelme und Narren in den Literaturen des Mittelalters : XXVII. Jahrestagung des Arbeitskreises Deutsche Literatur des Mittelalters (Greifswald), Eulenspiegelstadt Mölln, 24.-27. September 1992 1994   3894920270
PT1653 .P2\1994 Stricker, 13th cent Pfaffe Amis : Mittelhochdeutsch/Neuhochdeutsch : nach der Heidelberger Handschrift cpg 341 c 1994   3150006589
PT2528\Z6 T436\1999   Theodor Storm, narrative strategies and patriarchy = Theodor Storm, Erzählstrategien und Patriarchat c1999 99011297 0773481699
PT2662.E7 I6 1989 (VPL) Bernhard, Thomas In der Höhe : Rettungsversuch, Unsinn 1989   3701705852
PT2662.E7 Z7979 2000 Schmied, Erika Thomas Bernhards Österreich : Schauplätze seiner Romane c2000   3701712050
Q11 .N56 v.818 (P)   Self across psychology : self-recognition, self-awareness, and the self concept 1997 97020571 1573310344
Q175 .F828 Franklin, Allan, 1938- Experiment, right or wrong 1990 89023848 0521382076
Q175 .M64 vol. 13 (SCI) Q175 .M64 v.13   Scientific explanation c1989 89020248 0816617732
Q175 .N76 1999 (NjP f) Nugayev, Rinat M Reconstruction of mature theory change : a theory-change model c1999 99036556 0820436275
Q325.75 .F75 2001 Hastie, Trevor Elements of statistical learning : data mining, inference, and prediction c2001 2001031433 0387952845
Q327 .D83 2000 (CSt MATH-CS STACKS) Duda, Richard O Pattern classification 2001 99029981 0471056693
q96/23823 Proceedings (British Library Document Supply Centre)   Proceedings of the risk management : expanding horizons 1993   0894481762
QA 76.9 .D3 R237 2000 (LEE) Ramakrishnan, Raghu Database management systems c2000 99037109 0072322063
QA\927 .K693x\1999 Knobel, Roger, 1962- Introduction to the mathematical theory of waves 1999 99039055 0821820397
QA1 .G45 1996 (MAT) Gelfand Mathematical Seminars Gelfand Mathematical Seminars, 1993-1995 c1996   0817638164
QA164 .J84 2001 (PU math) Jukna, Stasys, 1953- Extremal combinatorics : with applications in computer science c2001 00055604 3540663134
QA188 .B73 1999 (NNU NYU Courant) Bressoud, David M., 1950- Proofs and confirmations : the story of the alternating sign matrix conjecture 1999 99020232 0521661706
QA22.D5623 S47\1982 Sesiano, Jacques Books IV to VII of Diophantus' Arithmetica in the Arabic translation attributed to Qusta ibn Luqa c1982 82019077 0387906908
QA248 .B376\1996 Barwise, Jon Vicious circles : on the mathematics of non-wellfounded phenomena c1996 96000809 1575860090
QA274.76 W44X\2000\(LC) Wegener, Ingo Branching programs and binary decision diagrams : theory and applications c2000 00035749 0898714583
QA276 .H788 2000 (CSt EDUCATION STACKS) Huck, Schuyler W Reading statistics and research 2000 99044928 0321023412
QA276.12 .K586 1987 Kitchens, Larry J Exploring statistics : a modern introduction to data analysis and inference c1987 86024585 0314284982
QA276.18 .H36 1999 (CSt EDUCATION STACKS)   Handbook for teaching statistics and research methods c1999 98033522 0805830499
QA276.4 .M267x\1993 Marazzi, Alfio, 1947- Algorithms, routines, and S functions for robust statistics : the FORTRAN library ROBETH with an interface to S-PLUS c1993 92020326 0534196985
QA276.6 .M77\2000 Mukhopadhyay, Parimal Topics in survey sampling 2001 [i.e. 2000] 00056271 0387951083
QA278 .G72 (SOC) \(LC)\ Green, Paul E Analyzing multivariate data c1978 77081241 003020786X
QA278 .K46 1999g Khattree, Ravindra Applied multivariate statistics with SAS software c1999   1580253571
QA278.5 +H386\1994 Hatcher, Larry Step-by-step approach to using the SAS system for factor analysis and structural equation modeling c1994 96128607 1555446434
QA278.6 .I58 1998 (P)   Interaction and nonlinear effects in structural equation modeling 1998 97049371 0805829504
QA29.P15 C38 1999 (NjP f) Castrucci, Sergio Luca Pacioli da'l Borgo San Sepolcro 1999    
QA297 B647X\1997\(LC) Borse, G. J. (Garold J.) Numerical methods with MATLAB : : a resource for scientists and engineers c1997 96039300 ///r97 0534938221
QA303 .H16 Hall, A. Rupert (Alfred Rupert), 1920- Philosophers at war : the quarrel between Newton and Leibniz 1980 79015724 0521227321
QA326 .B74 1987 (KLI) Bratteli, Ola Operator algebras and quantum statistical mechanics c1987-1997 86027877 0387170936
QA33 .V4813 1983 (F) Viète, François, 1540-1603 Analytic art : nine studies in algebra, geometry, and trigonometry from the Opus restitutae mathematicae analyseos, seu, Algebrâ novâ c1983 82021381 087338282X
QA371.35 .C66 1998 Cooper, Jeffery Introduction to partial differential equations with MATLAB 1998 97032251 0817639675
QA402.5 .K44 1999 Kelley, C. T Iterative methods for optimization 1999 99011141 0898714338
QA641 .G59 Godbillon, Claude, 1937- Géométrie différentielle et mécanique analytique .. 1969 76420748  
QA7 .M34457 2000   Mathematics : frontiers and perspectives c2000 99047980 0821820702
QA76.73 .C153 S24 1998 (CSt MATH-CS STACKS) Sahni, Sartaj Data structures, algorithms, and applications in C++ c1998 97031865 0071092196
QA76.73.P76 C57 1994 (NNU Courant) Clocksin, W. F. (William F.), 1955- Programming in Prolog 1994 94031331 0387583505
QA76.8.C55 T54x 1988 (SCI) Tiley, W. Edward Using Clipper c1992 91067188 0880228857
QA76.9.A43 M36 1999 (P) Man, K. F. (Kim F.), 1951- Genetic algorithms : concepts and designs c1999 98053817 1852330724
QA802 .W48 Westfall, Richard S Force in Newton's physics: the science of dynamics in the seventeenth century 1971 76139572 0444196110
QA9 .L624\1996   Logical reasoning with diagrams 1996 95041885 0195104277
QA90 .J33 2001 (CSt GREEN SSRC-CSLI) QA90 .J33 2001 (CSt GREEN STACKS) Jamnik, Mateja, 1973- Mathematical reasoning with diagrams : from intuition to automation c2001 2001047923 1575863235
QB475.A1 I36 1991 IAP Meeting (7th : 1991 : Paris, France) Extragalactic radio sources, from beams to jets : proceedings of the 7th IAP Meeting held at the Institut d'Astrophysique de Paris, Paris, France, 2-5 July 1991 1992 92225445 0521416027
QB479.55.M87 R34 1999   Radio galaxy Messier 87 : proceedings of a workshop held at Ringberg Castle, Tegernsee, Germany, 15-19 September, 1997 /cHermann Josef Roser, Klaus Meisenheimer (eds.) 1999 99042742 354066209X
QB582 .C48 1997 (MASTK) Chancer, Joni Moon journals : writing, art, and inquiry through focused nature study c1997 96050400 0435072218
QB721 .H292\1994   Hazards due to comets and asteroids c1994 94018759 0816515050
QC16.E5 C37 1995 Cassidy, David C., 1945- Einstein and our world 1995 94017472 0391038761
QC16.L26 B47 1987 Bensaude-Vincent, Bernadette Langevin : 1872-1946 : science et vigilance c1987   2701110815
QC173.3 .D42 1996 (NNU Bobst) Podesta, Michael de Understanding the properties of matter c1996   156032614X
QC173.6 .F86 1980 (KLI)   Fundamental principles of general relativity theories : local and global aspects of gravitation and cosmology c1980 80014826 0306404052
QC174.12 .G67 1997 (CSt PHYSICS STACKS) Goswami, Amit Quantum mechanics c1997 96083911 0697157970
QC174.17.G46 Q3 1994 ((FTaSU) sci)   Quantization and infinite-dimensional systems c1994 94044822 0306448343
QC174.17.G46 Q32 1995   Quantization, coherent states, and complex structures c1996 95051189 0306452146
QC174.17.I76 I573 1995 International Symposium on Mathematical Physics (1994 : Arnold Sommerfeld Institute) Nonlinear, deformed and irreversible quantum systems : proceedings of the International Symposium on Mathematical Physics : Arnold Sommerfeld Institute, 15-19 August 1994, Clausthal, Germany c1995   9810222661
QC174.35.S2 C87 1990 ((FTaSU) sci) Cushing, James T., 1937- Theory construction and selection in modern physics : the S matrix 1990 90031048 0521381819
QC174.52\.C66 S36\1997 Schottenloher, Martin, 1944- Mathematical introduction to conformal field theory : based on a series of lectures given at the Mathematisches Institut der Universität Hamburg c1997 97007263 //r97 3540617531
QC178 .T47 1989   Three hundred years of gravitation 1989, c1987   0521379768
QC20.7.G76 M63 1995   Modern group theoretical methods in physics : proceedings of the conference in honour of Guy Rideau 1995 95033175 0792336453
QC20.7.S65 B46 1988 Benn, I. M. (Ian M.) Introduction to spinors and geometry with applications in physics c1988 87021117 0852741693
QC761 .T86 1965 (PHY) QC761 .T86 1965 Turov, Evgenii Akimovich Physical properties of magnetically ordered crystals 1965 64066185  
QC794.6.S3 N47 1982 (P) Newton, Roger G Scattering theory of waves and particles c1982 81023326 0387109501
QC981.8.C5 M36 2001g Markgraf, Vera Interhemispheric climate linkages 2001   0124726704
QD181.P1 S96 1982 (CONM) QD181.P1 S96 1982 Symposium on Adsorption on and Surface Chemistry of Hydroxyapatite (1982 : Kansas City, Mo.) Adsorption on and surface chemistry of hydroxyapatite c1984 83024738 030641516X
QD281.O9 H63 2000 (CHEM) Hodnett, B. K Heterogeneous catalytic oxidation : fundamental and technological aspects of the selective and total oxidation of organic compounds 2000 99052447 0471489948
QD281.P6 F6 v.129 (P) Schopf, G Polythiophenes : electrically conductive polymers c1997   3540614834
QD431.25.A53 A45 2001   Amino acid analysis protocols 2001 00023798 0896036561
QD511.8 .B369 1989 Barin, Ihsan Thermochemical data of pure substances c1989 89017034 089573866X
QD79.C45 G77 1986 ((FTaSU) sci) Grob, Kurt Making and manipulating capillary columns for gas chromatography c1986   3778513125
QD903.6.H63 F47 1998 (PU vanp) Ferry, Georgina Dorothy Hodgkin : a life 1998   1862071675
QE\43 .S46x\1995 Sen, Mrinal K Global optimization methods in geophysical inversion 1995 95012651 0444817670
QE719 .T36 Tappan, Helen Ni~na, 1917- Paleobiology of plant protists c1980 80014675 0716711095
QE720 .P14\1990   Packrat middens : the last 40,000 years of biotic change c1990 89038454 0816511152
QE721 .S54 (SCI) Shipman, Pat, 1949- Life history of a fossil : an introduction to taphonomy and paleoecology 1981 80029053 0674530853
QE752.B6 S36 1991g (GLG)   Santana fossils : an illustrated atlas c1991   0866225498
QE841 .V66\1969 \Quarto\ Voorhies, Michael R Taphonomy and population dynamics of an early Pliocene vertebrate fauna, Knox County, Nebraska 1969 72197287  
QE841 .W413 1989 Weigelt, Johannes, 1890-1948 Recent vertebrate carcasses and their paleobiological implications 1989 89004698 0226881660
QH104.5 .S6 B77 1996 (CSt BIOLOGY STACKS) Briggs, Mark K. (Mark Kendig), 1961- Riparian ecosystem recovery in arid lands : strategies and references 1996 96009957 0816516421
QH14 .H46 1997 (CSt GREEN STACKS) Hinchman, Hannah Trail through leaves : the journal as a path to place c1999   0393041018
QH195.A23 E38 1996 (P)   East African ecosystems and their conservation 1996 95052333 0195108175
QH431 .B226 2001 (PU vanp) Barash, David P Revolutionary biology : the new, gene-centered view of life c2001 2001017123 0765800675
QH45.5 .R495\1998 Rezendes, Paul Wild within : adventures in nature and animal teachings c1998 98011725 0874779316
QH506 .M45 (CSt BIOLOGY STACKS)   Phospholipid signaling protocols c1998 98003874 0896034917
QH540.5 .U42 1997 Ulanowicz, Robert E Ecology, the ascendent perspective / : Robert E. Ulanowicz 1997 96037899 0231108281
QH541.15\E24 B75X\1999\(LC) British Ecological Society. Symposium (40th : 1999 : University of Sussex) Ecological consequences of environmental heterogeneity : the 40th symposium of the British Ecological Society, held at the University of Sussex, 23-25 March 1999 2000 00027087 0632057130
QH541.28 .E36 1998   Ecological scale : : theory and applications c1998 97048512 0231105029
QH55 .B87 1991 Burnie, David How nature works c1991 91012432 ///r93 0895773910
QH625.A1 G7 Grove, W. B. (William Bywater), 1848-1938 British stem- and leaf-Fungi (Coelmycetes); a contribution to our knowledge of the Fungi imperfecti belonging to the Sphaeropsidales and the Melanconiales 1935-37 35016766  
QH75 .M65 1996   Molecular genetic approaches in conservation 1996 96024804 019509526X
QH77.A8 N28 1991   Nature conservation. 2, The role of corridors 1991   0949324353
QK154 .S68 Small, John Kunkel, 1869-1938 From Eden to Sahara: Florida's tragedy 1929 agr31000517  
QK474 .P63x\1983 Plant Adaptation Workshop (1983 : Tromsø, Norway) Plant production in the North : proceedings from "Plant Adaptation Workshop," Tromsø, Norway, September 4-9, 1983 c1985    
QK495\O64 +L315X\2000\(LC) Lavarack, P. S. (Peter S.) Dendrobium and its relatives c2000 00039226 0881924903
QK625.C6C650 1992 (ICU JCL Sci)   Colletotrichum : biology, pathology and control c1992   0851987567
QK625.M4 C66 2000 (ICU JCL Sci)   Colletotrichum : host specificity, pathology, and host-pathogen interaction c2000   0890542589
QL494 .B86x\1994 Büning, Jürgen Insect ovary : ultrastructure, previtellogenic growth and evolution 1994 93074897 0412360802
QL551\C6 B76\1957 Brown, F. Martin (Frederick Martin), 1903- Colorado butterflies 1957 a 58004349  
QL552 .A29 1993 Acorn, John Harrison, 1958- Butterflies of Alberta 1993 cn 93091138 1551050285
QL552 .B88\1989   Butterflies of Manitoba 1989 89191570 0920704166
QL552 .L39\1998 Layberry, Ross A Butterflies of Canada c1998 cn 97931702 0802008984
QL552 H66\1973 Hooper, Ronald R Butterflies of Saskatchewan [1973] 74150706  
QL676.5 .D381 DeGraaf, Richard M Trees, shrubs, and vines for attracting birds : a manual for the Northeast 1979 78019698 0870232665
QL731.S6 S55 1990q (SZ) Skinner, John D Mammals of the southern African subregion 1990 91189713 0869798022
QL751.65.M3 M35 (NNU Bobst) McFarland, David Quantitative ethology 1981 81001246 0273084178
QL785 .D631 1986 Domjan, Michael, 1947- Principles of learning and behavior 1986 85005276 0534052088
QM451 +S43 1965 (MED) Sidman, Richard L Neuroanatomy, a programmed text [1965- 65016630 //r85  
QM551 .F34 1986 (BIO) Fawcett, Don Wayne, 1917- Textbook of histology 1986 85008218 0721617298
QOV (Bertillon, A. Ethnographie moderne) Bertillon, Alphonse, 1853-1914 Ethnographie moderne. Les races sauvages. Les peuples de l'Afrique, les peuples de l'Amerique, les peuples de l'Océanie, quelques peuples de l'Asie .. [1882]    
QP151.R9 (ICU JCL Sci) Ryle, John A. (John Alfred), 1889- Gastric function in health and disease 1926 sg 27000009  
QP363.3 .C47 2000 (NNU NYU Bobst)   Cerebral reorganization of function after brain damage 2000 99047749 0195120264
QP363.5 .H365 2001 (PU vanp)   Handbook of developmental cognitive neuroscience 2001 00046567 026214073X
QP363.5 +H365X\2001\(LC)   Handbook of developmental cognitive neuroscience 2001 00046567 026214073X
QP475 .D35 1995 Daw, Nigel W Visual development c1995 95032577 0306450232
QP519.9.C36 C373 1998 (DANA)   Capillary electrophoresis : : theory and practice c1998 97022491 084939127X
QP535.S8 H36   Handbook of stable strontium c1981 80016090 0306404176
QP801.P64 B54 1992   Biodegradable polymers and plastics c1992 93119632 0851862071
QR103 .E37 1996 Ehrlich, Henry Lutz, 1925- Geomicrobiology c1996 95040328 0824795415
QU136\H236\1998   Handbook of proteolytic enzymes c1998 98023079 0120793709
R154.P374 A35 (SCI) Peller, Sigismund, 1890- Not in my time : the story of a doctor c1979 79083607 0802222390
R-23747 (CRLL)   Evraziia--istoricheskie vzgliady russkikh emigrantov 1992 93192815 5201004148
R726.7 .H36 1995 (NNU Bobst) R726.7 .H36 1995 (NNU Bobst)   Handbook of health and rehabilitation psychology 1995 95040862 0306449706
R726.7 .S75 1994   Psychosocial processes and health : a reader 1994 93049004 0521416108
RA1147.5 .F665 1999 (PU vanp)   Forensic neuropsychology : fundamentals and practice c1999 99022363 9026515448
RA410 .F69 (F) Fox, Daniel M Economists and health care : from reform to relativism 1979 79022036 0882021281
RA418 .L66 1997 Lorber, Judith Gender and the social construction of illness c1997 97004588 0803958137
RA418.3.D48 T48 1983 (NEWM) RA418.3.D48 T48 1983   Third world medicine and social change : a reader in social science and medicine c1983 83012542 0819134198
RA448.5.C45 S53 2001 (PU vanp) Shah, Nayan, 1966- Contagious divides : epidemics and race in San Francisco's Chinatown c2001 2001027615 0520226283
RA448.5\C45 S53X\2001\(LC) Shah, Nayan, 1966- Contagious divides : epidemics and race in San Francisco's Chinatown c2001 2001027615 0520226283
RA468\.C37 S65x\1998 Solano Alonso, Jairo, 1949- Salud, cultura y sociedad : Cartagena de Indias, siglos XVI y XVII [1998]   9589180825
RA499 M87\1996\(LC) Murard, Lion Hygiène dans la République : la santé publique en France, ou, l'utopie contrariée : 1870-1918 c1996 97128679 221359788X
RA643.7.F8 A37 1999 Aisenberg, Andrew Robert Contagion : disease, government, and the "social question" in nineteenth-century France c1999 98036505 0804733953
RB127 .H358 1999   Handbook of pain syndromes : biopsychosocial perspectives 1999 98036687 //r98 0805826807
RB152 M84\1995 (KSL)   Multiple chemical sensitivity : a scientific overview c1995 94074818 0911131531
RC 1210 .A22x 2000 (LEE)   ABC of sports medicine 2000   0727913662
RC 267 .A77 1999 (LEE)   Unequal burden of cancer : an assessment of NIH research and programs for ethnic minorities and the medically underserved 1999 99006105 0309071542
RC 386.6 .N48 P73 2000 (LEE)   Practitioner's guide to evaluating change with neuropsychological assessment instruments c2000 99057688 030646361X
RC137 .D457\1997   Dengue and dengue hemorrhagic fever c1997 97013184 0851991343
RC262.C78 (ICU JCL Sci) Cope, John Cancer: civilization: degeneration. The nature, causes and prevention of cancer, especially in its relation to civilization and degeneration, with fifty-five illustrations 1932 sg 32000015  
RC327 E97 1990 (PU vanp) European Congress on the History of Psychiatry and Mental Health Care (1st : 1990 : 's Hertogenbosch, Netherlands) Proceedings of the 1st European Congress on the History of Psychiatry and Mental Health Care : 's-Hertogenbosch, the Netherlands, 24-26 October 1990 1993   9052350361
RC348 N45\2000 Nell, V Cross-cultural neuropsychological assessment : theory and practice c2000 99032682 0805833552
RC372.A2 E65\1994   Epilepsy and quality of life c1994 94004424 0781701759
RC386.6.N48 N474 2000 (NNU NYU Bobst)   Neuropsychological assessment in clinical practice : a guide to test interpretation and integration c2000 99019227 0471193259
RC451.4.A5 H39 1997   Handbook of neuropsychology and aging c1997 97012001 0306454602
RC451.N5 S23 1999 (NNU NYU Bobst) Sadowsky, Jonathan Hal Imperial bedlam : institutions of madness in colonial southwest Nigeria c1999 99010222 0520216172
RC454.4 .D483\1995   Developmental psychopathology c1995 94036391 0471532576
RC454.4 P726\1999   Primary care psychiatry and behavioral medicine : brief office treatment and management pathways c1999 98042017 0826112242
RC455.4 .S87\E83\1997   Evaluating stress : a book of resources 1997 96042961 0810832313
RC456 .H35 1993   Handbook of effective psychotherapy c1993 93023996 0306444283
RC46.M9 (ICU JCL Sci) Musser, John Herr, 1856-1912. ed Handbook of practical treatment 1911-17 11001495  
RC473.N48 N47 1996 (NNU Bobst)   Neuropsychological assessment of neuropsychiatric disorders 1996 95049329 019509073X
RC514 N35\2000   Negative symptom and cognitive deficit treatment response in schizophrenia c2001 00023099 0880487852
RC550 953G Ginzberg, Eli, 1911- Psychiatry and military manpower policy, a reappraisal of the experience in World War II 1953 53012344  
RC552.S62 E95\1999   Extreme fear, shyness, and social phobia : origins, biological mechanisms, and clinical outcomes 1999 98051459 0195118871
RC660 .H364\1994   Handbook of psychology and diabetes : a guide to psychological measurement in diabetes research and practice c1994 94004391 3718655624
RC685.C6 T95 1991 (SW)   Type A behavior c1991 90024163 0803940890
RC840.I903 (ICU JCL Sci) Ivy, A. C. (Andrew Conway), 1893- Peptic ulcer 1950 50004047  
RC969.H43 G85 1992 (MAIN)   Guidelines for employee health promotion programs c1992 91028162 0873223519
RJ1 .J17   Journal of developmental and behavioral pediatrics : JDBP [1980- 80644911//r85  
RJ47.5 .C4415 1996 (NNU Bobst)   Child development and behavioral pediatrics 1996 96015892 0805823646
RJ506.A58 A585 2001 (ICU JCL Sci)   Anxiety disorders in children and adolescents : research, assessment, and intervention 2001 00033696 0521789664
RJ506.O66 B87 2000 (NNU NYU Bobst) Bustamante, Eduardo M Treating the disruptive adolescent : finding the real child behind oppositional defiant disorders c2000 99037817 0765702355
RK66 952P Page, Melvin E Degeneration, regeneration [c1949] 50004475  
RM301.41 .T486 1996 (NNU Bobst)   Textbook of receptor pharmacology c1996 96014485 0849392276
RM666.E55 H68 1985 (BMAIN) Howell, Edward, 1898- Enzyme nutrition : the food enzyme concept c1985 85011222 0895293005
S535.A3 A6 1947 Amadeo, Tomás, 1880-1950 Redención por la mujer 1947    
S605.5 .E366 1994   Economics of organic farming : an international perspective c1994 gb 95018953 085198911X
S62734 A12t Smith, Mimi, 1942- This is a test c1983 82051221 0898220319
SB191 M2\E2 East, Edward M. (Edward Murray), 1879-1938 Inheritance in maize 1911]    
SB608.A6 M28 1996 MacHardy, William E Apple scab : biology, epidemiology, and management c1996 95080654 0890542066
Sc D 99-2181 Helper, Laura Whole lot of shakin' going on : an ethnography of race relations and crossover audiences for rhythm & blues and rock & roll in 1950s Memphis 1997    
SD12.M4 G82 Massachusetts. Superintendent for suppressing the gypsy and brown-tail moths Annual report .. 1906- 08022396  
SD383 .P36 1997 Pakenham, Thomas, 1933- Meetings with remarkable trees c1997 96043550 0679456929
SF281 .M58 1999 Mills, D. S Equine behaviour : : principles and practice 1999 98055558 0632048786
SF780.4 .V59 1990 (VET) SF780.4 .V59 1990   Virus infections of ruminants 1990 90229645 0444873120
SF810.A3 M33 1986 (VET)   Manual of veterinary parasitological laboratory techniques 1986 gb 88023202 0112427243
STX (Argentina Republic. Justicia e Instrucción Pública, Ministerio de. Antecedentes sobre enseñenza secundaria) Argentina. Ministerio de Justicia é Instrucción Pública Antecedentes sobre enseñenza secundaria y normal en la República argentina .. 1903 07037172  
STY (Justicia) (Argentine Republic. Ministerio de justicia e instrucción pública. Reformas orgánicas) Argentina. Ministerio de Justicia e Instrucción Pública Reformas orgánicas en la enseñanza pública . 1916    
T C16bop (LAW) Canada. Bureau of Management Consulting Operation compulex; information needs of the practicing lawyers [1972] 74182107  
T\14\.5 .S68\1994 \+\   Image of technology in literature, the media and society 199?    
T\57\.85 .N456x\1995   Network models 1995 95175001 0444892923
T1993\.F421 Fett, Darlene L Adolescent female voice : the effect of vocal skills instruction on measures of singing performance and breath management 1993    
T3R70L   Court of Arches, Minute Book      
TA140.S8A3 (ICU JCL Sci) Stevens, John F. (John Frank), b. 1853 Engineer's recollections 1936] 36009570  
TA1634 .T783x 1998 (P) Trucco, Emanuele Introductory techniques for 3-D computer vision c1998   0132611082
TA405 .P54 1991 ((FTaSU) sci) Pisidhi Karasudhi Foundations of solid mechanics c1991 90048510 0792307720
TA460 B76 Brown, William F., 1922- Plane strain crack toughness testing of high strength metallic materials [c1966] 66029517 //r84  
TD196\.P4 H93\1994   Hydrocarbon bioremediation c1994 94002907 //r94 0873719840
TD482 .C474 1995 Cesario, Lee Modeling, analysis, and design of water distribution systems c1995 95139177 0898677580
TD482 .C58 1998 Clark, Robert Maurice Modeling water quality in drinking water distribution systems 1998 98036443 0898679729
TD746 .E53   Emergency planning for municipal wastewater facilities 1989 89039334 0943244463
TD758.5.H43 M5 1981a (ENG) Minear, R. A Data base for influent heavy metals in publicly owned treatment works 1981?]    
TG6\Y12\O\Ar23\Xar2 Archer, Cathaline Alford John Clark Archer, a chronicle 1959] 59038179  
TH 4815 .S395 2000 (LEE) Scutella, Richard M How to plan, contract, and build your own home c2000 99035570 0071346090
TH7975.D8 M33 Maril, Nadja American lighting, 1840-1940 c1989 89084163 //r90 0887401775
Thesis\1982 Nurik, Tracey Sue Study of Elisabetta Sirani and her works in American colletions 1982    
Thesis\1996\S931 (MUSIC) Thesis\ML\30\1996\S931 \+\ Stuart, Kathryn Marks of emphasis in Beethoven piano sonatas 1996    
Thesis\D\212\1994\T925 \+\ (ARCHV) Thesis\1994\T925 Tumpek-Kjellmark, Katharina C., 1957- From Hitler's widows to Adenauer's brides : towards a construction of gender and memory in postwar West Germany, 1938-1963 1994    
Thesis\PN\38\1993\S631 \+\ (ARCHV) Thesis\1993\S631 Slawney, James Jay, 1962- Phantom of reason : oneirocriticism from Baudelaire to Benjamin 1993    
TJ755 .H45 1988 (BUEN) Heywood, John B Internal combustion engine fundamentals c1988 87015251 007028637X
TJ820 .G55 1999 Gipe, Paul Wind energy basics : : a guide to small and micro wind systems c1999 98054585 1890132071
TK 7874 .H82 1998 (LEE) Huang, Shi-Yu, 1965- Formal equivalence checking and design debugging c1998 98023993 079238184X
TK145 .T5 1951 Timbie, William Henry, 1877- Principles of electrical engineering [1953,c1951] 51011758  
TK5101 .K87 \+\ Kotel'nikov, V. A Theory of optimum noise immunity 1959 [c1960] 59009990  
TK5984 .A38 1997   Acoustic wave sensors : : theory, design, and physico-chemical applications c1997 96021931 0120774607
TK7871.15.P6 C37 1999 (PU engi) Chandrasekhar, Prasanna Conducting polymers, fundamentals and applications : a practical approach c1999 99037935 0792385640
TK7874.65 .R33 1996 (BUEN) Rabaey, Jan M Digital integrated circuits : a design perspective c1996 95022672 0131786091
TK7887.5 .S43 1998 Sells, Chris Windows telephony programming : a developer's guide to TAPI c1998 98020433 0201634503
TL220 .W343 1994 ((FTaSU) sci) Wakefield, Ernest Henry, 1915- History of the electric automobile : battery-only powered cars 1994 93032254 1560912995
TL724 .R45 1999 Reid, Constance Slacks and calluses : our summer in a bomber factory c1999 99031365 156098368X
TP1175.E9 R37 1994 (PU town) Rauwendaal, Chris Polymer extrusion c2001 2001039609 1569903212
TP159.C46 T48 1997 Thompson, Michael, 1942- Surface-launched acoustic wave sensors : : chemical sensing and thin-film characterization c1997 96044729 0471127949
TP248.65.P76 P69 1997 (PU town)   Protein-based materials c1997 96028021 0817638482
TP680 .E33\1990 \Quarto\   Edible fats and oils processing : basic principles and modern practices : world conference proceedings c1990 90001029 0935315306
TP680 .T35\1997   Technology and solvents for extracting oilseeds and nonpetroleum oils c1997 97042900 0935315810
TR140 H89 A4 1980   Souvenirs de Jersey 1852-1853 d1980    
TR642 .T45 1982 (MAIN)   Thinking photography 1982   0333271955
TR660 .C655x 1999 (TYL) Collett, John Black & white landscape photography c1999   1584280042
TR680 .S62 1999 (PU fine) Sobieszek, Robert A., 1943- Ghost in the shell : photography and the human soul, 1850-2000 : essays on camera portraiture c1999 99025393 0262194252
TR681 .W6 L56 1996 (CSt ART STACKS) Lindbergh, Peter 10 women c1996   3823814168
TS176 .I6385 1988 International Conference on Expert Systems and the Leading Edge in Production Planning and Control (2nd : 1988 : Charleston, S.C.) Expert systems and intelligent manufacturing : proceedings of the Second International Conference on Expert Systems and the Leading Edge in Production Planning and Control, held May 3-5, 1988 in Charleston, South Carolina c1988 88007130 0444013253
TS1892 .T7 1975 Treloar, L R G Physics of rubber elasticity 1975   0198513550
TT506 .V4 Vecchio, Walter Fashion makers, a photographic record [1968] 67027050  
TT920 .S685 1999 (MAOVR) Speight, Charlotte F., 1919- Hands in clay c1999 98050031 0767405013
TX392 .V42\1996 \Quarto\   Vegan handbook : over 200 delicious recipes, meal plans, and vegetarian resources for all ages c1996 96060113 0931411173
U21.2 .V57 (BUR) (LEH) Virilio, Paul Pure war c1983   0936756039
U820.G7 W43 1989   Weapons and warfare in Anglo-Saxon England 1989   0947816216
UA700 .J3813 1972 (MAIN) Jaurès, Jean, 1859-1914 Democracy and military service; an abbreviated translation of L'armée nouvelle 1972 70147769//r83 0824004671
Ukb19\884s Schellen, H. (Heinrich), 1818-1884 Magneto-electric and dynamo-electric machines: their construction and practical application to electric lighting and the transmission of power 1884 07027882  
Uxe729\939b Beaudza, Louis Formation de l'armée coloniale 1939 39033990  
Video\record\7892\VHS   Terror 2000 [videoreording] [1990]    
WG\20092 Avé-Lallemant, Eberhard Kategoriale Ort des Seelischen in der Naturwirklichkeit; eine Untersuchung auf der Grundlage der realontologischen Arbeiten von Hedwig Conrad-Martius 1959    
WH500\H689231\1999   Hodgkin's disease c1999 98055677 0781715024
WI700\L783458\1994   Liver gene expression c1994 94027240 1570590974
Wis Mss CH Isham, Ruth Eliza Wales Papers, 1880-1884, 1897-1900      
WM203.5\H236\1997   Handbook of autism and pervasive developmental disorders c1987 87006104 0471812315
WN32\H251w Harshaw, Josephine Perfect When women work together : a history of the Young Women's Christian Association in Canada 1966 67104625  
XXKF8915.W753 1994 (ICU DLL Law) Wright, Edward T Winning courtroom strategies c1994 93049652 0131251708
YRA (International congress for psychical research (3d : Paris : 1927) Compte rendu) International congress for psychical research (3d : Paris : 1927) Compte rendu du IIIème Congès international de recherches psychiques, à Paris, septembre-octobre 1927 1928    
Z 213 .B7 M4 1964 (LEE) Medina, José Toribio, 1852-1930 Imprenta en Bogotá : y La inquisición en Cartagena de Indias 1952    
Z286.E43 H46 2001 Henke, Harold, 1956- Electronic books and epublishing : a practical guide for authors c2001 2001020858 1852334355
ZDVD 1883 (CSt GREEN MEDIA-MTXT)   Out of the present [videorecording] 1996   1565802713
    AAPG studies in geology 1979-    
    Advances in anatomy, embryology and cell biology   73645292  
    American realism and the canon c1994 94011782 0874135249
    Annals of the New York Academy of Sciences   12037287  
    Annual yearbook of the American Education Finance Association c1980- sf 88019781  
    Ars and texnh : art and craft of the Graeco-Roman world from 450 B.C. to 600 A.D. c1989    
    Attachment processes in adulthood 1994   1853021725
    Basic concepts of intercultural communication : selected readings c1998 98015278 1877864625
    Behavioral law and economics 2000   0521661358
    Bernini architect [videorecording] c1997    
    Biology of salt tolerant plants c1995 95078802 0964826011
    Birmingham news 1894- sn 83016047  
    Bold words : a century of Asian American writing c2001 00068346 0813529654
    Catalogue du Musâee Bourdelle 1990   290178416X
    Challenging the therapeutic state : critical perspectives on psychiatry and the mental health system c1990   0930195051
    Changing reels : Latin American cinema against the odds c1997   0952563630
    Chicago evening journal 1861-1896 sn 82016386  
    Chicago sun-times c1959- sn 82014807  
    Community, unity, communion : essays in honour of Mary Tanner 1998   0715157566
    Crime after crime 1999   0312967403
    Criminological theory : past to present : essential readings 1998 97033460 0935732918
    Current trends in grades and grading practices in undergraduate higher education : the results of the 1992 AACRAO Survey [1994?] 94003195 092985120X
    Cybercultures reader 2000   0415183782
    D'Arcy Collection of the Communications Library of the University of Illinois at Urbana-Champaign [microform] 1987]    
    Dartmouth atlas of cardiovascular health care c1999   155648285X
    Denver daily tribune   sn 82014227  
    Diamond, SiC and nitride wide bandgap semiconductors : symposium held April 4-8, 1994, San Francisco, California, U.S. 1994 94033153 1558992391
    Directory of indexing and abstracting courses and seminars c1998 98021546 1573870560
    Doctora Cecilia Grierson : homenaje pâostumo 1937    
    Education for national integration and development : report of Education Policy Review Commission      
    Encyclopedia of herbs and herbalism [1981], c1979 81009750 0517353261
    Encyclopedia of team-building activities c1991 90048873 0883902575
    Enterprising nation : renewing Australia's managers to meet the challenges of the Asia-Pacific century : managing for diversity 1995   0644432330
    Enterprising nation : renewing Australia's managers to meet the challenges of the Asia-Pacific century : report of the Industry Task Force on Leadership and Management Skills. Executive summary 1995   0644431261
    Enterprising nation : renewing Australia's managers to meet the challenges of the Asia-Pacific century. International best practice in leadership and management development 1995   0644430567
    Enterprising nation : renewing Australia's managers to meet the challenges of the Asia-Pacific century. Research report 1995   064443127X
    Enterprising nation : renewing Australia's managers to meet the challenges of the Asia-Pacific century. The Australian manager of the 21st century c1995   0644432349
    Environmental governance : a report on the next generation of environmental policy c2002 2001005927 0815702558
    Everyman's Book of classic horror stories 1976   0460011588
    Evraziæiskaëiìa khronika   51050763  
    Evraziæiskaëiìa khronika   51050763  
    Evraziæiskiæi vremennik 1923-1927 48034733  
    Forensic neuropsychology : fundamentals and practice c1999 99022363 9026515448
    Grandeur and obedience [videorecording] ; The light of experience 1993   0780013050
    Handbook for restoring tidal wetlands c2001 00030410 084939063X
    Handbook of literacy and technology : transformations in a post-typographic world 1998 97042351 0805826424
    Handbook of neuropsychology <2000-2001 > 00045467 0444503765
    Handbook of pain syndromes : biopsychosocial perspectives [1998], c1999 98036687 //r98 0805826807
    Handbook of solid waste management c1977 76020505 //r78 0442295502
    Haydn, the innovator : a new approach to the string quartets c2000   1900072378
    Historienbibel : Farbmikrofiche : Edition der Handschrift Hamburg, Staats- und Universitätsbibliothek, Cod. 8 in scrinio 1997   389219047X
    Homenaje a Manuel Ramos Otero, 1948-1990 [1992?]    
    IARC scientific publications   sn 83004798  
    India : another millennium? 2000 00289440 0670896454
    Innovation and tradition : essays on Renaissance art and culture 2000   8878903841
    Inside the law schools : a guide by students for students 1998 97038139 0452279461
    Inside the law schools : a guide by students for students 1998 97038139 0452279461
    Integrated resource assessment and management plan for Western District, Marsabit, Kenya 1983-1984 84983300  
    Integrating archaeological demography : multidisciplinary approaches to prehistoric population c1997 96083230 0881040819
    Integrating social sciences with ecosystem management : human dimensions in assessment, policy, and management c1999 99066154 1571672478
    International management : a reader c1995   0030990157
    Introduction to latent variable growth curve modeling : concepts, issues, and applications 1999 98041005 080583060X
    Journal of chemical ecology   75644091  
    Julia de Burgos 1986    
    Komplektovanåie krasnoæi armåii 1926    
    Lenguas de Panamâa 1974-<1980 > 75546130  
    Lenguas de Panamâa 1974-<1980 > 75546130  
    Linguistics in the Netherlands 1993 c1993   9027231532
    Matteo Bandello, novelliere Europeo : atti del Convegno Internazionale di Studi, 7-9 novembre 1980 1982    
    Measurement of stress, trauma, and adaptation c1996 96009819 1886968020
    Modern American women : a documentary history c1997 96022486 0070715270
    Molecular cell biology c2000 99030831 0716731363
    Mycota : a comprehensive treatise on fungi as experimental systems for basic and applied research 1994-<c2001> 94019413 3540577815
    Na putiakh; utverzhdenie evraziitsev 1922 49031605  
    Neurobiology of the neurotrophins 2001   1929675011
    Nonverbal communication reader : classic and contemporary readings c1999 99461869 1577660404
    Nonverbal communication reader : classic and contemporary readings c1999 99461869 1577660404
    Parsnips in the snow : talks with Midwestern gardeners 1990 89020439  
    Petersen's photographic [1979- 97657679  
    Physiology, biochemistry, and molecular biology of plant lipids c1997 96052352 0792343794
    Political Catholicism in Europe, 1918-1965 1996 95025450 0198203195
    Probláemes mathâematiques de la thâeorie des automates : sâeminaire M. P. Schèutzenberger, A. Lentin et M. Nivat, annâee 1969/70, Facultâe des sciences de Paris, Institut Henri Poincarâe 1970 75514256  
    Protocols for short term toxicity screening of hazardous waste sites 1988    
    Quality in health care : theory, application, and evolution 1995 94044355 0834206250
    Recusant translators : Elizabeth Cary and Alexia Grey c2000 99055940 184014226X
    Reference materials of the European communities : results of hemocompatibility tests c1992 92030458 0792320026
    Retired NBME basic medical sciences test items c1991    
    Reviews in environmental health, 2001 2001    
    Robert Colescott [videorecording] c1991    
    Rossiia i latinstvo 1923    
    Rules for reasoning 1993 92039042 0805812563
    Safe schools : a handbook for practitioners c1995   0882103040
    SAS language guide c1988   1555440916
    Schur lectures (1992) 1995 96157904  
    Self-conscious emotions : the psychology of shame, guilt, embarrassment, and pride c1995 94031710 0898622646
    Self-conscious emotions : the psychology of shame, guilt, embarrassment, and pride c1995 94031710 0898622646
    Setting the agenda : management reform in Australia : a discussion paper concerning Enterprising nation, the report of the Industry Task Force on Leadership and Management Skills 1995   085857053X
    Shakaiteki sogo koi no kenkyu 1987 88135186 /AJ  
    Silicon carbide : a review of fundamental questions and applications to current device technology 1997   3055017927
    Social identity and intergroup relations 1982 81021676 0521246164
    Sociological methodology   68054940  
    Sovremennoe prochtenie Pushkina : mezhvuzovskii sbornik nauchnykh trudov 1999 00299555 5780701008
    Sports medicine handbook 1999   0727910310
    Survey methodology bulletin [microform] [1977-    
    Survey methodology bulletin [microform] [1977-    
    Survey methodology bulletin [microform] [1977-    
    Survey methodology bulletin [microform] [1977-    
    Survey methodology bulletin [microform] [1977-    
    Survey methodology bulletin [microform] [1977-    
    Toxicological profile for polycyclic aromatic hydrocarbons [1995]    
    Urban ecosystems c1997- 97643340  
    Writing and selling the romance novel c1983 83006859 0871161346
    Your first romance c1984 83021256 0312897901
  Abel, Maria Gertrud, 1904- Versuch einer erkenntnistheoretischen Grundlegung der Geschichtsphilosophie .. 1938    
  Adams, Clementina R Common threads : themes in Afro-Hispanic women's literature 1998 96061937 0897298276
  Ahlin, Lars, 1946- Principles of wireless communications c1998   9144314213
  Alderman, Tracy Scarred soul : understanding & ending self-inflicted violence c1997 97066073 1572240792
  Aleandri, Emelise Italian-American immigrant theatre of New York City 1999   0738500976
  Algemene Vereniging voor Taalwetenschap (Netherlands). Meeting (27th : 1996 Utrecht) Linguistics in the Netherlands 1996 1996   1556192207
  Ambelain, Robert Au pied des menhirs; introduction áa l'âetude des doctrines celtiques 1945 af 47006829  
  Ambelain, Robert Dans l'ombre des cathâedrales 1939 39014174  
  American Academy in Rome Maya Lin c1998   8843568329
  Andersen, Marin Negative affectivity and accuracy in symptom reporting... 1995    
  Appleton, Nancy Healthy bones : what you should know about osteoporosis c1991 90020404 0895294621
  Asala, Joanne Celtic folklore cooking 1998 98003993 1567180442
  Bacho, Roderick Effects of acculturation, ethnic identity commitment, and family coping on Filipino-American family matrons' severity of psychological symptoms and attitudes towards mental health services 1997    
  Backman, Paul Variation in pathgenicity, morphology and RAPD... 1997    
  Barlaz, Morton A Microbiological and chemical dynamics during refuse decomposition in a simulated sanitary landfill 1988    
  Barney, Steve T Relationship between Christian religious beliefs, attributions, world views, and psychological symptoms in a population with a history of significant negative life events 1997    
  Batin, Christopher Fishing Alaska on dollar$ a day : a comprehensive guide to fishing, hunting & outdoor recreation in Alaska's national forests 1992 91076370 0916771261
  Benjamin, Walter, 1892-1940 Iluminaciones, II: Baudelaire; un poeta en el esplendor del capitalismo [1972]    
  Benjamini, Eli Immunology : a short course c2000 00022485 0471348902
  Bernabâe, Jean Eloge de la Crâeolitâe c1993   2070733238
  Bible. Hausa. 1979 Littafi mai tsarki : duk da Afokirifa (ko Deuterocanonical) c1979   0564011428
  Bingham, Caleb, 1757-1817 Columbian orator [microform] : containing a variety of original and selected pieces ; together with rules, calculated to improve youth and others in the ornamental and useful art of eloquence 1817    
  Bivin, William Edward Nasal harmonies of twelve South American languages 1986    
  Blumberg, Ernest Richard, 1954- Consumer directed support for individuals with developmental disabilities: perspectives of family members and support providers 1998    
  Bombaci, Nancy Margaret Freaks and desire : fetishizing bodily difference in late modernist American culture 2000    
  Boone, Louis E Contemporary business 2000 c2000 99074473 0030262569
  Bothma, J. du P Carnivore ecology in arid lands c1998 97037163 3540592652
  Brahms, Johannes, 1833-1897 Trio : fèur Klavier, Violine und Waldhorn (oder Violoncello oder Viola) ; Opus 40 ; Es-dur [19--]    
  Brahms, Johannes, 1833-1897 Trio : op. 40      
  Bratteli, Ola Operator algebras and quantum statistical mechanics c1987-c1997 86027877 0387170936
  British School at Rome Catalogue of the ancient sculptures preserved in the municipal collections of Rome .. 1912- 14004918  
  British social attitudes (Codebook) British social attitudes ... survey   sn 98030219  
  Brodo, Irwin M Lichens of North America c2001 00049541 0300082495
  Bronson, Gary J Program development and design using C++ c2000 99056075 0534371302
  Bruice, Paula Yurkanis, 1941- Organic chemistry : study guide and solutions manual c1998    
  Buisson, F. E. (Ferdinand Edouard), 1841-1932 Politique radicale [microform], âetude sur les doctrines du parti radical et radicalsocialiste 1908    
  Cahill, Marie Patrick Joseph Changing patterns in the National Education Association from conservative professionalism to active unionism 1970    
  Calderío, Francisco 15 de marzo; análisis y perspectivas. [Microform] 1942    
  Campbell, Toni Children's understanding of television commercials containing misleading nutritional information 1979    
  Campbell, Toni Format cues and content difficulty as determinants of children's cognitive processing of televised educational messages 1983    
  Carr, John Dickson, 1906-1977 Black spectacles 1942    
  Casadesus, Gaby Ma technique quotidienne = My daily technique : une approche de quelques difficultés pianistiques de la musique française = an approach to some of the difficulties in the piano technique of French music c1992 94702577  
  Champion, Dean J Research methods for criminal justice and criminology 2000 99053409 0130139041
  Champion, Dean J Research methods for criminal justice and criminology 2000 99053409 0130139041
  Charmont, J. (Joseph), 1859-1922 Transformations du droit civil 1912 12017502  
  Chesley, Jill Louise Effects of normalized occupation on the lives of adults with mental retardation ... 1993    
  Chesner, Craig Alan Toba Tuffs and Caldera Complex, Sumatra, Indonesia : insights into magma bodies and eruptions 1988    
  Christopher Molyneux An Investigation into the Determinants Influencing the Decision Regarding the Method of Disposition of the Dead Within the Cape Town Area February 1985    
  Coloquio Internacional "Literatura y Espacio Urbano" (1st : 1993 : Alicante, Spain) Actas del I Coloquio Internacional "Literatura y Espacio Urbano" c1994 95110898 //r962 8475991556
  Congress of Industrial Organizations (U.S.). Constitutional Convention Proceedings of the ... Constitutional Convention of the Congress of Industrial Organizations 1948-1955 sn 85021260  
  Conner, Howard M Spearhead; the World War II history of the 5th Marine Division [1950] 50013407  
  Connolly, Peter, 1935- Hannibal and the enemies of Rome 1978 79065844 0356059057
  Conrad-Martius, Hedwig, 1888- Naturwissenschaftlich-metaphysische Perspektiven : drei Vorträge c1948    
  Consejo Nacional de Mujeres de la Repâublica Argentina Revista del Consejo Nacional de Mujeres de la Repâublica Argentina [microform] 1901- sf 94093098  
  Cromwell, Paul F Community-based corrections c2002 2001026062 0534559662
  Cross, K. Patricia (Kathryn Patricia), 1926- Feedback in the classroom : making assessment matter 1988    
  Crothers, Linda J., 1962- Affiliation to the Twelve-Step philosophy of Alcoholics Anonymous and its impact on substance abuse treatment 1999    
  Cvijiâc, Jovan, 1865-1927 Questions balkaniques [1917?- 17028779  
  Dâavila, Marâia de Lourdes Desembarcos en el papel : la imagen la literatura de Julio Cortâazar 2001   9508450975
  Daily graphic (New York, N.Y.) Daily graphic : an illustrated evening newspaper 1873-1889 sn 83045184  
  Damodara, 17th cent [Sangitadarpana. The mirror of music and dance] Bydrage tot de kennis der voor-Indische muziek .. 1930    
  Danticat, Edwidge, 1969- Farming of bones 1999 98042680 0786217324
  Daugherty, Paul L Effects of three exercise intensities on the alpha brain wave activity of adult males 1986    
  Donnelly, Linda Sue Comparative cellular ultrastructure and chemical characterization of envelopes of three species of Trachelomonas (Euglenophyta) 1979    
  Dreher, Nan H Public Parks in Urban Britain... 1993    
  Dubofsky, Melvyn, 1934- Labor in America : a history c1999 99017713 0882959794
  Duhl, Lisa S Rocking an empty cradle : a psychological study of Yiddish Holocaust lullabies 1999    
  Dullea, Mark Marine biopolymers [1994] 96125163 1569650268
  Dunning, John Stewart, 1906- South American birds : a photographic aid to identification c1987 88006299 0915180251
  Eddins, Don AEA : head of the class in Alabama politics : a history of the Alabama Education Association c1997 98070314  
  Enig, Mary G Know your fats : the complete primer for understanding the nutrition of fats, oils and cholesterol 2000 2001273748 0967812607
  Evers, Gerd, 1942- Traunstein, 1918-1945 : ein Beitrag zur politischen Geschichte der Stadt und des Landkreises Traunstein c1991   3927909076
  Fallon, Sally Nourishing traditions : the cookbook that challenges politically correct nutrition and the diet dictocrats c1995 97143385 1887314156
  Fan, H. M Effective slab width of simple span steel I-beam composite bridges at ultimate load : interim report no. AW-120-3 1976    
  Fehr, Barbara Yankee denim dandies c1974 74079127 //r75 0878320148
  Fenollosa, Ernest Francisco, 1853-1908 Outline of the history of Ukiyo-ye : illustrated with twenty reproductions in Japanese wood engravings 1901 03003116  
  Flach, Patricia B Qualitative investigation of teaching for success : educating children with special needs in general education, elementary classroom environments c2000    
  Flament, Ivon Coffee flavor chemistry c2002 2001024880 0471720380
  Fonsegrive, George, 1852-1917 Morale et sociâetâe 1907    
  Ford, Mary Towards the restoration of allegory : christology, epistemology and narrative 1990    
  Ford, Michael Thomas Little book of neuroses : ongoing trials from my queer life 2001 2001046074 1555836437
  Foucault, Michel History of sexuality 1990-   0679724699
  Fournier, Christiane Bâebâe colonial : une enfance au Tonkin 1935    
  Fox, Robert W., 1934- Introduction to fluid mechanics [1998?] 99160483 0471124648
  Francis, Martha Elizabeth Analysis of the language and process dimensions found in personal disclosure : the LIWC approach 1993    
  Fraser, Margaret R Critical program components for preparing teachers to educate diverse learners : a national perspective 1998    
  Fries, Elizabeth Overconfidence in health knowledge and predictions of personal health behaviors 1992    
  Fujita Rony, Dorothy Bintang "You got to move like hell" : trans-Pacific colonialism and Filipina/o Seattle, 1919-1941 1996    
  Gackle, Martha Lynne Effect of selected vocal techniques for breath management, resonation, and vowel unification on tone production in the junior high school female voice 1987    
  Gallagher, Janet M Telling stories about God : narrative voice and epistemology in the Hebrew Bible and in the fiction of Flannery O'Connor, Graham Greene and Cynthia Ozick 1990    
  Gambia Constitution of the Republic of the Gambia, 1997 [1997]   9983860112
  Gat, Irit Incarcerated mothers : effects of the mother/offspring life development program (MOLD) on recidivism, pro social moral development, empathy, hope, and parent-child attachment 2000    
  Gettman, Dennis Jerald Investigation of the shared mental model construct in the context of a complex team task 2001    
  Gilbert, Adrian Going to war in Ancient Greece 2001 00043545 0531145905
  Gillespie, Aline Widening horizons : the YWCA in Queensland 1888-1988 1995   0949525235
  Girgis-Hanna, Mary F Aging with mental retardation : a growing concern 1997    
  Glos, P Reliability theory for timber structures: determination of compression ...      
  Glymour, Bruce Model of causal, statistical explanation in evolutionary biology 1995    
  Gofbarg, Gadi Strategies of Hans Haacke 1990    
  Gooch, Bryan N. S Musical settings of late Victorian and modern British literature : a catalogue 1976 75024085 0824099818
  Goodrich, Michael T Data structures and algorithms in Java c2001 00043294 0471383678
  Gray, Asa, 1810-1888 Scientific papers of Asa Gray 1889 05036438  
  Grierson, Cecilia, 1859-1934 Educacion tâecnica de la mujer : informe presentado al Sr. Ministro de Instrucciâon Pâublica de la Repâublica Argentina 1902    
  Groslier, George, 1887- Donneurs de sang, roman 1942    
  Gurney, Ivor, 1890-1937 Western playland (and of sorrow), song-cycle for baritone voice, string quartet and pianoforte 1926    
  Gushchina, K. A Gosudarstvennyi arkhiv Ivanovskoi oblasti : putevoditel' 1962 95193097  
  Harrison, Lou, 1917- Music primer; various items about music to 1970 c1971] 73152541  
  Hart, Kitty Return to Auschwitz : the remarkable story of a girl who survived the Holocaust 1985, c1981   0689706375
  Harter, Susan, 1939- Manual for the self-perception profile for adolescents 1988    
  Harvey, Carol P Understanding and managing diversity : readings, cases, and exercises c2002 2001036163 0130292648
  Helbig, Gerhard Deutsche Partikeln--richtig gebraucht? 1995   3324006082
  Hendricks, Cheryl Margaret "We knew our place" : a study of the constructions of colouredidentity in South Africa 2000    
  Hernaâandez, Ana Marâia Mujer mexicana en la industria textil 1940 43045631  
  Hernaâandez, Ana Marâia Mujer mexicana en la industria textil 1940 43045631  
  Hewitt, John S., 1948- Optimal foraging models for the lower Illinois River Valley 1983    
  Hindley, J. Roger Basic simple type theory 1997 95009058 0521465184
  Hogan, Thaddeus, 1842- Sermons, doctrinal and moral 1915    
  Holroyd, Jean Questionnaire on resources and stress : for families with chronically ill or handicapped members c1987 92235828 0884220974
  Horvath, Brandon Joseph Comparison of Colletotrichum spp. causing crown rotting anthracnose to Colletotrichum graminicola and Colletotrichum sublineolum isolates using isozyme markers 1999    
  Hubbard, Edward E Measuring diversity results c1997   1883733170
  Hubbard, Phil Sex and the city : geographies of prostitution in the urban West c1999 99076363 0754610799
  Hughes, Howard Raymond History of Delanco Camp Meeting Association 1961    
  Hugo, Charles Victor, 1826-1871 Homes de Lâexil : prâecâedâesde "mes fils" Victor Hugo 1875    
  Imbruno, Kathleen Poesâia feminista puertorriqueäna : de la toma de conciencia a la toma de la palabra 1986, c1987    
  Inness, Sherrie A Dinner roles : American women and culinary culture c2001 00053637 087745762X
  International Conference on the Guodian Laozi (1998 : Dartmouth College) Guodian Laozi : proceedings of the international conference, Dartmouth College, May 1998 2000 00021567 1557290695
  International congress of anthropology. (1893: Chicago) Memoirs of the International congress of anthropology 1894 04027528  
  International Marine Biological Workshop (3rd : 1988 : Albany, W.A.) Marine flora and fauna of Albany, Western Australia : proceedings of the Third International Marine Biological Workshop c1990-c1991 92150327 0730939537
  International Symposium on Controlled Release of Bioactive Materials (17th : 1990 : Reno, Nev.) Proceedings : 17th International Symposium on Controlled Release of Bioactive Materials, July 22-25, 1990, Reno, Nevada, U.S.A. c1990    
  International Symposium on Fundamentals of Rock Joints (1985 : Bjèorkliden, Sweden) Fundamentals of rock joints : proceedings of the International Symposium on Fundamentals of Rock Joints, Bjèorkliden, 15-20 September 1985 1985   918699803X
  Jackson, Tamara Roberta, 1956- Social support network of a sample of drug-abusing women and their prenatally drug-exposed children 2000    
  Johnson, Cathy (Cathy A.) Sierra Club guide to painting in nature c1999 99014619 0871569345
  Johnson, Keith M., 1941- Classical horn concerto cadenza 1976    
  Johnson, Leslie Faye Shostakovich Viola Sonata: An analytical performer's guide 1991    
  Jurafsky, Dan, 1962- Speech and language processing : an introduction to natural language processing, computational linguistics, and speech recognition 2000 99087845 0130950696
  Kailin, Julie Engaging teachers in anti-racist pedagogy : an historical and ethnographic study c1996    
  Kauffmann, Norman L Impact of study abroad on personality change 1983    
  Keen, W. C. (William Charles) Cacti and succulents : step-by-step to growing success 1990 92170370 1852232641
  Kennedy, David (David Daniel) Feng shui for dummies c2001 00109409 0764552953
  Kinsley, William J Document photography : its use in court ca. 1910]    
  Koch, Todd The psychological effects of traumatic brain injury as measured by the Minnesota Multiphasic Personality Inventory 2 2001    
  Koppich, Julia Studies of excellence in teacher education : preparation in a five-year program c2000 00364731 0965453553
  Kreiner, Robert Paul Status study of existing procedures for textbook selection in Ohio 1980    
  Kudrewicz, Jacek Czñestotliwoâsciowe metody w teorii nieliniowych uk±adâow dynamicznych 1970 70299100  
  LaHaye, Tim F Apollyon : the Destroyer is unleashed c1999 98032064 0842329161
  LaHaye, Tim F Desecration : Antichrist takes the throne c2001 2001003115 084233226X
  LaHaye, Tim F Left behind : a novel of the earth's last days c1995 95019132 0842329110
  Laqueur, Walter, 1921- Was niemand wissen wollte : die Unterdrèuckung der Nachrichten èuber Hitlers "Endlèosung" c1981   3550079478
  Laubscher, Michael R Encounters with difference : student perceptions of the role of out-of-class experiences in education abroad 1994 93037505 0313289778
  Le, Tao Underground step 1 answers : to the NBME retired & self-test questions : preparation for the USMLE step 1 c1996 00500884  
  Lee, Samuel Mau-Cheng, 1948- Comparative study of leadership selection process among four Chinese leaders 1985    
  Lee, Sangho Social cognitive approach to leadership : application of self-efficacy theory to leadership at the dyad and group levels of analysis 1992    
  Leslie, Clare Walker Keeping a nature journal : discover a whole new way of seeing the world around you c2000 00030748 1580173063
  Liu, Jih-Shiou, 1960- Evolution of the fungal tribe Balansieae (Clavicipitaceae) and related endophytes of grasses 1993    
  Lleâo Caänal, Vicente Nueva Roma : mitologâia y humanismo en el renacimiento sevillano 1979 80126415 8450035104
  Lomborg, Bj˛rn, 1965- Skeptical environmentalist : measuring the real state of the world c2001 00068915 0521804477
  Loos, Eugene E Verbos performativos : partâiculas que tienen signâificado performativo o significado relacionado a los performativos en idiomas panos 21 cm    
  Mandel, Mark Alan Phonotactics and morphophonology in American Sign Language 1981    
  Manure Management in Harmony with the Environment and Society (1998 : Ames, Iowa) Manure management in harmony with the environment and society [1998]    
  Marcuse, Herbert, 1898- Ende der Utopie. Herbert Marcuse diskutiert mit Studenten und Professoren Westberlins an der Freien Univ. Berlin èuber die Mèoglichkeiten und Chancen einer politischen Opposition in den Metropolen in Zusammenhang mit den Befreiungsbewegungen in den L [1967] 73578999  
  Marquis, Alice Goldfarb Art biz : the covert world of collectors, dealers, auction houses, museums, and critics c1991 90024788 0809242834
  Maxfield, Michael G Research methods for criminal justice and criminology c1998 97028501 0534521649
  McCulloch, Charles E Generalized, linear, and mixed models 2001 00059430 047119364X
  McCullough, Edo World's Fair midways; an affectionate account of American amusement areas from the Crystal Palace to the crystal ball [1966] 65028078  
  McCunn, Ruthanne Lum Thousand pieces of gold : a biographical novel 1988, c1981 88047881 0807083178
  McMillan, Vicky, 1947- Writing papers in the biological sciences c1997 95080799 0312115040
  McNeal, Mark Patrick The effects of grain and particle size on the microwave dielectric properties of ferroelectric barium titanate 1997    
  Mehlferber, Jon Paul, 1964- Dwelling as a sculptural motif : a critical analysis of selected contemporary works 1993    
  Mendelson, Elliott Introduction to mathematical logic 2001, c1997   0412808307
  Miller, Albert Basil Effective width of a plate supported by a beam." 1929 30008967  
  Miller, John David Henry Augustus Rowland and his electromagnetic researches 1970    
  Minten, Bart; Kyle, Steven The effect of distance and road quality on food prices... 1995    
  Moeran, E. J. (Ernest John), 1894-1950 Ludlow town : four poems from A Shropshire lad [19--?]    
  Monk, David H Educational finance : an economic approach c1990 88032242 0075572370
  Montgomery daily advertiser (Montgomery, Ala. : 1858) Montgomery daily advertiser   sn 84023549  
  Moravia, Alberto, 1907- Agostino / Alberto Moravia 1981, c1945    
  Morelle, Chantal Henri Laugier : un espirit sans frontières 1997   2802710559
  Moritz, Sandra Elaine Effect of task type on the relationship between efficacy beliefs and performance 1998    
  Morse, Sidney E. (Sidney Edwards), 1794-1871 Memorabilia in the life of Jedidiah Morse, D.D. : formerly pastor of the First Church in Charlestown, Mass. 1867    
  Munkres, James R., 1930- Topology c2000 99052942 0131816292
  Myers, Jane, 1955- Shores of a dream : Yasuo Kuniyoshi's early work in America 1996 96031120 0883600862
  Nalty, Linda Pearson Social networks of women and men in residential treatment for chemical dependency 1997    
  News & observer (Raleigh, N.C. : 1894) News & observer 1894-    
  Newton, Michael, 1931- Destiny of souls : new case studies of life between lives 2000 00028270 1567184995
  Nietzsche, Friedrich Wilhelm, 1844-1900 Nietzsche reader 1977 78300925 0140443290
  Nygren, Richard Edwin, 1964- Leadership of work teams : factors influencing team outcomes 1996    
  Oh, Sang-Ryong Korean numeral classifiers : semantics and universals 1994    
  Orr, C. W. (Charles Wilfred), 1893-1976 Shropshire lad : 7 songs c1934    
  Otero, Luiz Soledade, 1940- Butterflies : Beauty and behavior of Brazilian species c1990 93832370 8585352027
  Parasession on the Lexicon (1978 : Chicago, Ill.) Papers from the Parasession on the Lexicon, Chicago Linguistic Society, April 14-15, 1978 1978 78056478  
  Parker, Leonard Emanuel, 1938- Creation of particles in an expanding universe : a thesis 1966    
  Parsons, Clare Olivia Women and the walk : female flãanerie and the aesthetics of public space in 19th century Europe 1996    
  Patterson, Gerald R Coercive family process c1982   0916154025
  Paul, Ileana Malagasy Clause Structure 2000    
  Pearl, Eric Reconnection : heal others, heal yourself c2001 2001016545 1561708194
  Plato Plato : Republic, book I 1940    
  Pomey, J.-B. (Jean Baptiste), 1861- Cours d'electricitâe thâeorique, professâe áa l'Ecole professionnelle supâerieure des postes et tâelâegraphes 1914-1931    
  Poor, Walter A Differential geometric structures c1981 80019888 0070504350
  Popoviâc, Marko Stari grad Ras 1987 89135102  
  Poulsen, Vagn, 1909- Etruskische Kunst. Hrsg. Vagn Poulsen [1969è    
  Powell, Deborah Ann, 1949- Retrospective case studies of individual and group decision making in district-level elementary reading textbook selection 1986    
  Prado, Manuel Conquista de la Pampa [microform] : cuadros de la guerra de frontera 1960    
  Prestamo, Anne M Comprehensive inventory of technology and computer skills for academic reference librarians [microform] 2000    
  Pyle, Robert Michael Watching Washington butterflies; an interpretive guide to the State's 134 species, including most of the butterflies of Oregon, Idaho, and British Columbia [1974] 73094500 0914516035
  Quann, C. James Plus (+) minus (-) grading : a case study and national implications 1987    
  Ravel, Maurice, 1875-1937 Concerto pour piano et orchestre : avec râeduction de l'orchestre pour un second piano c1932    
  Renteln, Alison Dundes International human rights : universalism versus relativism c1990 89024251 0803935056
  Revilla, Linda A., 1960- Manifestations of ethnic identity : Pilipino Americans 1989    
  Rezendes, Paul Tracking & the art of seeing : how to read animal tracks & sign 1999 98045867 0062735241
  Richards, J. D Blood of the Vikings 2001   0340733853
  Riis, P. J. (Poul Jørgen), 1910- Etruscan types of heads : a revised chronology of the archaic and classical terracottas of Etruscan Campania and Central Italy 1981 83153698 8773041157
  Robbins, Todd Jeffrey, 1963- Questioning the community question [microform] : Wal-Mart, place identity and a classic New England town 1998    
  Rocard, Yves Électricité 1951 51001527  
  Rogers, Carla S How to get into the right dental school c1999 98028071 0844264547
  Rugh, Wilson J Linear system theory c1996 95021164 0134412052
  Sandler, Wendy, 1949- Sequentiality and simultaneity in American Sign Language phonology [microform] 1987    
  Saunders, William, 1836-1914 Descriptive catalogue of plants in the exotic collection of the Department of Agriculture 1872 agr09002310  
  Schlingensief, Christoph, 1960- Talk 2000 c1998 98144507 3216303756
  Schneider, David I Brief course in QBasic : with an introduction to Visual Basic c1994 94004806 0024077410
  Schnell, Rainer, Dr Nonresponse in Bevölkerungsumfragen : Ausmass, Entwicklung und Ursachen 1997   3810018171
  Schwalbenberg, Alma Villegas Ego and ethnic identity development in Filipino adolescents : an Asian perspective 1993    
  Schwarz, Stephen C Energy and resource recovery from waste 1983 83013110 0815509596
  Serials (Oxford, England) Serials : the journal of the United Kingdom Serials Group 1988- 90656021  
  Shafer, Susan, Dr Writing effective report card comments c1997 97198017 0590068822
  Sharp, Lynn Louise Rational religion, irrational science : men, women, and belief in French spiritism, 1853-1914 1996    
  Shattles, Bob Revival fire and glory : a Baptist minister recounts experiences with a new wave of God's glory c1999   1884369847
  Smith, Daryl Raymond Effect of transactive memory and collective efficacy on aircrew performance 1999    
  Song, Qi-Gen Formulas for stress ratio and effective flange width of simple and continuous I, T and box beams 1984    
  Southard, Frank A. (Frank Allan), 1907- American industry in Europe 1931 31035397  
  Sparks, Nicholas Walk to remember c1999 99012079 0446525537
  Spindel Conference (13th : 1995 : University of Memphis) Spindel Conference 1995 : explanation in the human sciences c1996    
  Spitz, Chantal T Ile des reves âecrasâes 1991   2908405245
  Stein, Edith, 1891-1942 Briefe an Hedwig Conrad-Martius [1960] 72201933  
  Steinberg, Kerri P Photography, philanthropy, and the politics of American Jewish identity 1998    
  Stokes, Maura Ellen Categorical data analysis using the SAS system c2000 2001280004 1580257100
  Stone, Deborah A Policy paradox : the art of political decision making c1997 96052119 039396857X
  Stratton, Patricia David, 1957- Factors that moderate and mediate outcome in children of alcoholics 1997    
  Stravinsky, Igor, 1882-1971 Tango : piano [c1941]    
  Stuckenbruck, Loren Theo "Do not worship me, worship God" : the problem of angel veneration in early Judaism and aspects of angelomorphic Christology in the Apocalypse of John 1994    
  Sullivan, Steve, 1954- Va va voom! : bombshells, pin-ups, sexpots and glamour girls c1995 95077537 1881649601
  Suzuki, Takashi Semilinear elliptic equations c1994   4762504122
  Sy, Tidiane Confrérie sénégalaise des mourides; un essai sur l'Islam au Sénégal [1969]    
  Talbot, Alfred Kenneth, 1916- History of the Virginia Teachers Association, 1940-1965 1981    
  Tan, Soo Tang Applied calculus c1994 93033269 0534935370
  Tasso, Torquato, 1544-1595 Discorso della virtáu feminile e donnesca 1997   8838913358
  Taylor, Marcia Baxter, 1951- Development of the measure of epistemological reflection 1983    
  Thomas, W. Hugh (Walter Hugh), 1935- SS-1 : the unlikely death of Heinrich Himmler 2001 2001409468 1841153060
  Thomas, W. Hugh (Walter Hugh), 1935- Strange death of Heinrich Himmler : a forensic investigation 2002 2001048995 0312289235
  Thorson, Kristine Stone wall secrets 1998 97049982 0884481956
  Tolman, William Howe, 1861- Social engineering; a record of things done by American industrialists employing upwards of one and one-half million of people, 1909 09006279  
  Tomioka, Satoshi, 1963- Focusing effects and NP interpretation in VP ellipsis [microform] 1997    
  Triplett, Kathy, 1949- Handbuilt tableware : making distinctive plates, bowls, mugs, teapots, and more c2001 00063488 1579902049
  Tsvetaev, E. M Mestnye Sel§sko-Khoziaistvennye Muzei i ikh Organizatsiia 1928    
  Tucker, Marcia Not just for laughs : the art of subversion : [exhibition] Terry Allen ... [et al.], the New Museusm [1981?] 81081189  
  United States. Children's Bureau Child care arrangements of full-time working mothers 1959    
  United States. Congress. House. Committee on International Relations. Subcommittee on Africa Confronting Liberia : hearing before the Subcommittee on Africa of the Committee on International Relations, House of Representatives, One Hundred Seventh Congress, first session, March 14, 2001 2001   0160656184
  United States. Employment Standards Administration. Wage and Hour Division Education industry in Puerto Rico : an economic report 1976    
  Van Lier, Leo Interaction in the language curriculum : awareness, autonomy, and authenticity 1996 95039097 0582248795
  Virgil Aeneid IX 1979   0906515386
  Virgil Aeneid X 1990   1853990450
  Viviáes, Albert Ame de la Cochinchine 1924 44038754  
  Walls, Jean Marie Turcotte, 1957- Narrative and representation in French colonial literature of Indochina 1994    
  Warner, Richard, 1943- Recovery from schizophrenia : psychiatry and political economy 1985 85002199 0710099797
  Weinraub, Eugene J Chrâetien's Jewish grail : a new investigation of the imagery and significance of Chrâetien de Troyes's grail episode based upon medieval Hebraic sources 1976 75029182 0884380025
  Wells, David (David Alan) Political ecologist c2000 99076343 0754611191
  Wenger, Win Discovering the obvious c1998   0931865530
  West, Larry Ketner, 1947- Cellular organization and biomineralization of the envelope of Trachelomonas hispida var. coronata 1977    
  White, Christopher, 1930- Dutch pictures in the collection of Her Majesty the Queen 1982 81012268 0521242835
  Winkiel, Laura A Passionate modernism : intellectuals, the masses and narrative rupture in twentieth-century novels and manifestoes 1999    
  Wood, Elizabeth Anne Working in the fantasy factory : interaction, intimacy and the construction of power in strip clubs 1999    
  Wu, San-Jarn, 1957- Literary study of Isaiah 63-65 and its echo in Revelation 17-22 [microform] 1995    
  Yi, Kwang-gyu, 1932- Kinship system in Korea 1975 76368464  
  Zubiaur, Josâe Benjamâin, 1856- Sinopsis de la educacion en la Republica Argentina .. 1901    
  Zuccari, Carlo True method of playing an adagio [MICROFORM] : made easy by twelve examples : first, in a plain manner with a bass then with all their graces : adapted for those who study the violin [17--?]    
5/2/2002         1


 
URL: http://www.libraries.rutgers.edu/rul/staff/access_serv/reports/call_num_reports_02_01_01-02_03_31.shtml
Website Feedback  |  Privacy Policy
© Copyright 1997-, Rutgers University Libraries